Clone BO01402 Report

Search the DGRC for BO01402

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptmRpL55-RA
Protein status:BO01402.pep:
Sequenced Size:355

Clone Sequence Records

BO01402.3prime Sequence

353 bp (352 high quality bases) assembled on 2005-11-30

> BO01402.3prime
ATGGTCTAGAAAGCTTGCCTTCTTTTTGATGTACTTCATGTACTTCTTGG
CGTTGAAGTTGTCCTCCACCTCCTCCATGATCTTGACCTTCTTGCGCGGC
TTGCGGGCCTCCAATCTCGCTCTGCGCTCCGCATCGGTTAAGGTGCTCAG
ATCCAAGGGAAGCTTGATAATCTTCCTGGGCTCGTGATAGCGGATGTTTA
TCGTGGATCCATCGGGTTGCACCACAACTGTGGGATATAGCCGGCAGTAA
ACCGAGCGATGCAGCCTGGTAACCGCCGTCGTGGCCGATGAGATGCAGCG
TATCTGCTGAACAGCCTGGGGCAACTGTTTCAGCAACATGTCGACTGATA
ACT

BO01402.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG14283-PA 324 mRpL55-RA 1..321 339..19 1605 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:16:39
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL55-RA 456 CG14283-RA 88..408 339..19 1605 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:16:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19094642..19094818 163..339 885 100 Plus
3R 32079331 3R 19094442..19094587 19..164 730 100 Plus
Blast to na_te.dros performed 2015-02-12 10:16:38
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-element 4740 Doc3-element DOC3 4740bp 1159..1206 67..20 105 68.8 Minus

BO01402.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:27 Download gff for BO01402.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14283-PA 1..324 18..339 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:26:56 Download gff for BO01402.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14283-PA 1..324 18..339 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:48:28 Download gff for BO01402.3prime
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 73..409 13..351 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:01:17 Download gff for BO01402.3prime
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 76..412 13..351 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:01:17 Download gff for BO01402.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 19094642..19094830 163..351 97   Plus
3R 19094438..19094585 13..162 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:48:28 Download gff for BO01402.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14920364..14920552 163..351 97   Plus
arm_3R 14920160..14920307 13..162 98 <- Plus

BO01402.5prime Sequence

353 bp (352 high quality bases) assembled on 2005-11-30

> BO01402.5prime
GAAGTTATCAGTCGACATGTTGCTGAAACAGTTGCCCCAGGCTGTTCAGC
AGATACGCTGCATCTCATCGGCCACGACGGCGGTTACCAGGCTGCATCGC
TCGGTTTACTGCCGGCTATATCCCACAGTTGTGGTGCAACCCGATGGATC
CACGATAAACATCCGCTATCACGAGCCCAGGAAGATTATCAAGCTTCCCT
TGGATCTGAGCACCTTAACCGATGCGGAGCGCAGAGCGAGATTGGAGGCC
CGCAAGCCGCGCAAGAAGGTCAAGATCATGGAGGAGGTGGAGGACAACTT
CAACGCCAAGAAGTACATGAAGTACATCAAAAAGAAGGCAAGCTTTCTAG
ACC

BO01402.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:37:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG14283-PA 324 mRpL55-RA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 12:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL55-RA 456 CG14283-RA 88..408 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 12:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19094642..19094818 193..17 885 100 Minus
3R 32079331 3R 19094442..19094587 337..192 730 100 Minus
Blast to na_te.dros performed 2015-02-13 12:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-element 4740 Doc3-element DOC3 4740bp 1159..1206 289..336 105 68.8 Plus

BO01402.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:28 Download gff for BO01402.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14283-PA 1..324 17..338 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:26:58 Download gff for BO01402.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14283-PA 1..324 17..338 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:34:46 Download gff for BO01402.5prime
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 73..409 5..343 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:32:51 Download gff for BO01402.5prime
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 76..412 5..343 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:32:51 Download gff for BO01402.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 19094642..19094830 5..193 97   Minus
3R 19094438..19094585 194..343 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:34:46 Download gff for BO01402.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14920364..14920552 5..193 97   Minus
arm_3R 14920160..14920307 194..343 98 <- Minus

BO01402.complete Sequence

355 bp (355 high quality bases) assembled on 2006-04-03

GenBank Submission: FJ629483

> BO01402.complete
GAAGTTATCAGTCGACATGTTGCTGAAACAGTTGCCCCAGGCTGTTCAGC
AGATACGCTGCATCTCATCGGCCACGACGGCGGTTACCAGGCTGCATCGC
TCGGTTTACTGCCGGCTATATCCCACAGTTGTGGTGCAACCCGATGGATC
CACGATAAACATCCGCTATCACGAGCCCAGGAAGATTATCAAGCTTCCCT
TGGATCTGAGCACCTTAACCGATGCGGAGCGCAGAGCGAGATTGGAGGCC
CGCAAGCCGCGCAAGAAGGTCAAGATCATGGAGGAGGTGGAGGACAACTT
CAACGCCAAGAAGTACATGAAGTACATCAAAAAGAAGGCAAGCTTTCTAG
ACCAT

BO01402.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL55-RA 324 CG14283-PA 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:24:30
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL55-RA 456 CG14283-RA 88..408 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19094642..19094818 193..17 885 100 Minus
3R 32079331 3R 19094442..19094587 337..192 730 100 Minus
Blast to na_te.dros performed 2014-11-27 07:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-element 4740 Doc3-element DOC3 4740bp 1159..1206 289..336 105 68.8 Plus

BO01402.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:48:29 Download gff for BO01402.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 1..324 17..338 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:03:16 Download gff for BO01402.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 68..404 5..343 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:14:19 Download gff for BO01402.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 90..405 22..339 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:48:30 Download gff for BO01402.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 68..404 5..343 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:10:00 Download gff for BO01402.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL55-RA 93..408 22..339 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:10:00 Download gff for BO01402.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19094642..19094813 22..193 100   Minus
3R 19094438..19094585 194..339 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:14:19 Download gff for BO01402.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14920364..14920535 22..193 100   Minus
arm_3R 14920160..14920307 194..339 98 <- Minus

BO01402.pep Sequence

Translation from 16 to 355

> BO01402.pep
MLLKQLPQAVQQIRCISSATTAVTRLHRSVYCRLYPTVVVQPDGSTINIR
YHEPRKIIKLPLDLSTLTDAERRARLEARKPRKKVKIMEEVEDNFNAKKY
MKYIKKKASFLDH

BO01402.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL55-PA 107 CG14283-PA 1..107 1..107 542 100 Plus