Clone BO01404 Report

Search the DGRC for BO01404

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:4
Vector:pDNR-Dual
Associated Gene/Transcriptlolal-RA
Protein status:BO01404.pep:
Sequenced Size:415

Clone Sequence Records

BO01404.5prime Sequence

413 bp (412 high quality bases) assembled on 2005-11-30

> BO01404.5prime
GAAGTTATCAGTCGACATGATGTCGTCGGATCAACAGTTCTTTCTAAAAT
GGAACGATTTTCAAACGAATATGGTGACCTCGTTCCGTCACCTGCGCGAC
GAGAAGAGCTTCACAGATGTAACACTCGCCTGCGAGGGCCAAACCTGCAA
AGCCCACAAAATGGTGCTTTCCGCTTGCAGTCCCTACTTTAAAGCGCTAC
TGGAGGAGAACCCATCGAAGCATCCGATCATTATCCTGAAAGATGTCTCC
TACATTCACCTACAGGCTATACTGGAGTTCATGTACGCCGGTGAGGTGAA
CGTGTCCCAGGAACAATTGCCAGCATTTCTTAAGACCGCCGATCGCCTCA
AAGTGAAAGGCCTCGCAGAGACACCCAGTTCGATAAAGCGGGAAGGTGCA
AGCTTTCTAGACC

BO01404.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG5738-PB 384 lolal-RB 1..381 17..397 1905 100 Plus
CG5738-PA 384 lolal-RA 1..381 17..397 1905 100 Plus
CG5738-PC 384 lolal-RC 1..381 17..397 1905 100 Plus
CG5738-PD 384 lolal-RD 1..381 17..397 1905 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
lolal-RH 958 CG5738-RH 271..652 16..397 1910 100 Plus
lolal-RG 1005 CG5738-RG 318..699 16..397 1910 100 Plus
lolal-RF 1384 CG5738-RF 284..665 16..397 1910 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18155151..18155344 397..204 970 100 Minus
2R 25286936 2R 18155890..18155994 120..16 525 100 Minus
2R 25286936 2R 18155404..18155491 206..119 440 100 Minus
Blast to na_te.dros performed on 2015-02-13 01:11:54 has no hits.

BO01404.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:30 Download gff for BO01404.5prime
Subject Subject Range Query Range Percent Splice Strand
lolal-PB 1..384 17..400 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:00 Download gff for BO01404.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5738-PD 1..384 17..400 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:29:25 Download gff for BO01404.5prime
Subject Subject Range Query Range Percent Splice Strand
lolal-RE 382..767 12..397 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:02:45 Download gff for BO01404.5prime
Subject Subject Range Query Range Percent Splice Strand
lolal-RF 280..665 12..397 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:02:45 Download gff for BO01404.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 18155892..18155998 12..118 98   Minus
2R 18155405..18155491 119..205 100 <- Minus
2R 18155151..18155342 206..397 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:29:25 Download gff for BO01404.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14043397..14043503 12..118 98   Minus
arm_2R 14042910..14042996 119..205 100 <- Minus
arm_2R 14042656..14042847 206..397 100 <- Minus

BO01404.3prime Sequence

413 bp (412 high quality bases) assembled on 2005-11-30

> BO01404.3prime
ATGGTCTAGAAAGCTTGCACCTTCCCGCTTTATCGAACTGGGTGTCTCTG
CGAGGCCTTTCACTTTGAGGCGATCGGCGGTCTTAAGAAATGCTGGCAAT
TGTTCCTGGGACACGTTCACCTCACCGGCGTACATGAACTCCAGTATAGC
CTGTAGGTGAATGTAGGAGACATCTTTCAGGATAATGATCGGATGCTTCG
ATGGGTTCTCCTCCAGTAGCGCTTTAAAGTAGGGACTGCAAGCGGAAAGC
ACCATTTTGTGGGCTTTGCAGGTTTGGCCCTCGCAGGCGAGTGTTACATC
TGTGAAGCTCTTCTCGTCGCGCAGGTGACGGAACGAGGTCACCATATTCG
TTTGAAAATCGTTCCATTTTAGAAAGAACTGTTGATCCGACGACATCATG
TCGACTGATAACT

BO01404.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:37:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG5738-PB 384 lolal-RB 1..381 399..19 1905 100 Minus
CG5738-PA 384 lolal-RA 1..381 399..19 1905 100 Minus
CG5738-PC 384 lolal-RC 1..381 399..19 1905 100 Minus
CG5738-PD 384 lolal-RD 1..381 399..19 1905 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
lolal-RH 958 CG5738-RH 271..652 400..19 1910 100 Minus
lolal-RG 1005 CG5738-RG 318..699 400..19 1910 100 Minus
lolal-RF 1384 CG5738-RF 284..665 400..19 1910 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18155151..18155344 19..212 970 100 Plus
2R 25286936 2R 18155890..18155994 296..400 525 100 Plus
2R 25286936 2R 18155404..18155491 210..297 440 100 Plus
Blast to na_te.dros performed on 2015-02-12 10:17:18 has no hits.

BO01404.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:29 Download gff for BO01404.3prime
Subject Subject Range Query Range Percent Splice Strand
lolal-PB 1..384 16..399 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:26:59 Download gff for BO01404.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5738-PD 1..384 16..399 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:48:29 Download gff for BO01404.3prime
Subject Subject Range Query Range Percent Splice Strand
lolal-RE 382..767 19..404 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:02:34 Download gff for BO01404.3prime
Subject Subject Range Query Range Percent Splice Strand
lolal-RF 280..665 19..404 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:02:34 Download gff for BO01404.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 18155892..18155998 298..404 98   Plus
2R 18155405..18155491 211..297 100 <- Plus
2R 18155151..18155342 19..210 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:48:29 Download gff for BO01404.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14043397..14043503 298..404 98   Plus
arm_2R 14042910..14042996 211..297 100 <- Plus
arm_2R 14042656..14042847 19..210 100 <- Plus

BO01404.complete Sequence

415 bp (415 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629484

> BO01404.complete
GAAGTTATCAGTCGACATGATGTCGTCGGATCAACAGTTCTTTCTAAAAT
GGAACGATTTTCAAACGAATATGGTGACCTCGTTCCGTCACCTGCGCGAC
GAGAAGAGCTTCACAGATGTAACACTCGCCTGCGAGGGCCAAACCTGCAA
AGCCCACAAAATGGTGCTTTCCGCTTGCAGTCCCTACTTTAAAGCGCTAC
TGGAGGAGAACCCATCGAAGCATCCGATCATTATCCTGAAAGATGTCTCC
TACATTCACCTACAGGCTATACTGGAGTTCATGTACGCCGGTGAGGTGAA
CGTGTCCCAGGAACAATTGCCAGCATTTCTTAAGACCGCCGATCGCCTCA
AAGTGAAAGGCCTCGCAGAGACACCCAGTTCGATAAAGCGGGAAGGTGCA
AGCTTTCTAGACCAT

BO01404.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 23:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
lolal-RH 384 CG5738-PH 1..381 17..397 1905 100 Plus
lolal-RG 384 CG5738-PG 1..381 17..397 1905 100 Plus
lolal-RF 384 CG5738-PF 1..381 17..397 1905 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 23:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
lolal-RH 958 CG5738-RH 271..652 16..397 1910 100 Plus
lolal-RG 1005 CG5738-RG 318..699 16..397 1910 100 Plus
lolal-RF 1384 CG5738-RF 284..665 16..397 1910 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 23:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18155151..18155344 397..204 970 100 Minus
2R 25286936 2R 18155890..18155994 120..16 525 100 Minus
2R 25286936 2R 18155404..18155491 206..119 440 100 Minus
Blast to na_te.dros performed on 2014-11-27 23:50:50 has no hits.

BO01404.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:28 Download gff for BO01404.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RC 1..384 17..400 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:15 Download gff for BO01404.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RC 262..647 12..397 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:39:42 Download gff for BO01404.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RE 387..767 17..399 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:28 Download gff for BO01404.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RD 303..688 12..397 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:09:32 Download gff for BO01404.complete
Subject Subject Range Query Range Percent Splice Strand
lolal-RF 285..665 17..399 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:09:32 Download gff for BO01404.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18155892..18155993 17..118 100   Minus
2R 18155405..18155491 119..205 100 <- Minus
2R 18155148..18155342 206..399 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:39:42 Download gff for BO01404.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14043397..14043498 17..118 100   Minus
arm_2R 14042910..14042996 119..205 100 <- Minus
arm_2R 14042653..14042847 206..399 98 <- Minus

BO01404.pep Sequence

Translation from 16 to 415

> BO01404.pep
MMSSDQQFFLKWNDFQTNMVTSFRHLRDEKSFTDVTLACEGQTCKAHKMV
LSACSPYFKALLEENPSKHPIIILKDVSYIHLQAILEFMYAGEVNVSQEQ
LPAFLKTADRLKVKGLAETPSSIKREGASFLDH

BO01404.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
lolal-PH 127 CG5738-PH 1..127 1..127 657 100 Plus
lolal-PG 127 CG5738-PG 1..127 1..127 657 100 Plus
lolal-PF 127 CG5738-PF 1..127 1..127 657 100 Plus
lolal-PE 127 CG5738-PE 1..127 1..127 657 100 Plus
lolal-PD 127 CG5738-PD 1..127 1..127 657 100 Plus