Clone BO01406 Report

Search the DGRC for BO01406

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptTaf13-RA
Protein status:BO01406.pep: full length peptide match
Sequenced Size:442

Clone Sequence Records

BO01406.3prime Sequence

440 bp (439 high quality bases) assembled on 2005-11-30

> BO01406.3prime
ATGGTCTAGAAAGCTTGCTTTGAGCTTGCCTTCGGTGCCCACATACTTGA
TCTCATCGAAGGCCTTTCGTGCCTTTTTCAACTCCTCGTTCATGGTCAGA
AGATCCTTCACCCTAGCGTACTTTCGGGGATCTTTGCGCACCAGGAAGAT
AATGTCTTCGACTTGAACACGGCCTGTTCGACCGATCTCCATTGCCCGGT
GAGTGGTCTCAGCTATATACTCAATGACCAGGTCTTCCAACAGATCTACG
GTTTCCGTGTATGGATTTTTGTCGTCTCCGAATCCGAACATCATGCAGCG
CAGCTCCTTGCTGAATAGGCGCTTTCGTCCTGAGTTGGTAGCCACAAATT
GGTCATCCTCCGCGTCGTCATCAAAGTTGAAATCACCGCCCTCGAAATTC
TCCTCTGGCATGCTATTTGAGGCCATGTCGACTGATAACT

BO01406.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG10756-PA 411 Taf13-RA 1..408 426..19 2015 99.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
Taf13-RA 628 CG10756-RA 82..489 426..19 2025 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:21:08
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20093317..20093660 38..381 1705 99.7 Plus
2L 23513712 2L 20093724..20093768 382..426 225 100 Plus
Blast to na_te.dros performed on 2015-02-11 04:21:10 has no hits.

BO01406.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:33 Download gff for BO01406.3prime
Subject Subject Range Query Range Percent Splice Strand
Taf13-PA 1..411 16..426 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:04 Download gff for BO01406.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10756-PA 1..411 16..426 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 05:01:20 Download gff for BO01406.3prime
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 76..496 13..433 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:00:43 Download gff for BO01406.3prime
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 76..496 13..433 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:00:43 Download gff for BO01406.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 20093724..20093774 382..433 94   Plus
2L 20093318..20093660 39..381 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 05:01:20 Download gff for BO01406.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20093724..20093774 382..433 94   Plus
arm_2L 20093318..20093660 39..381 99 <- Plus

BO01406.5prime Sequence

440 bp (439 high quality bases) assembled on 2005-11-30

> BO01406.5prime
GAAGTTATCAGTCGACATGGCCTCAAATAGCATGCCAGAGGAGAATTTCG
AGGGCGGTGATTTCAACTTTGATGACGACGCGGAGGATGACCAATTTGTG
GCTACCAACTCAGGACGAAAGCGCCTATTCAGCAAGGAGCTGCGCTGCAT
GATGTTCGGATTCGGAGACGACAAAAATCCATACACGGAAACCGTAGATC
TGTTGGAAGACCTGGTCATTGAGTATATAGCTGAGACCACTCACCGGGCA
ATGGAGATCGGTCGAACAGGCCGTGTTCAAGTCGAAGACATTATCTTCCT
GGTGCGCAAAGATCCCCGAAAGTACGCTAGGGTGAAGGATCTTCTGACCA
TGAACGAGGAGTTGAAAAAGGCACGAAAGGCCTTCGATGAGATCAAGTAT
GTGGGCACCGAAGGCAAGCTCAAAGCAAGCTTTCTAGACC

BO01406.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG10756-PA 411 Taf13-RA 1..408 17..424 2015 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
Taf13-RA 628 CG10756-RA 82..489 17..424 2025 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20093317..20093660 405..62 1705 99.7 Minus
2L 23513712 2L 20093724..20093768 61..17 225 100 Minus
Blast to na_te.dros performed on 2015-02-13 06:01:27 has no hits.

BO01406.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:34 Download gff for BO01406.5prime
Subject Subject Range Query Range Percent Splice Strand
Taf13-PA 1..411 17..427 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:06 Download gff for BO01406.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10756-PA 1..411 17..427 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 17:50:05 Download gff for BO01406.5prime
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 76..496 10..430 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:10:06 Download gff for BO01406.5prime
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 76..496 10..430 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:10:06 Download gff for BO01406.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 20093724..20093774 10..61 94   Minus
2L 20093318..20093660 62..404 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 17:50:05 Download gff for BO01406.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20093724..20093774 10..61 94   Minus
arm_2L 20093318..20093660 62..404 99 <- Minus

BO01406.complete Sequence

442 bp (442 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629485

> BO01406.complete
GAAGTTATCAGTCGACATGGCCTCAAATAGCATGCCAGAGGAGAATTTCG
AGGGCGGTGATTTCAACTTTGATGACGACGCGGAGGATGACCAATTTGTG
GCTACCAACTCAGGACGAAAGCGCCTATTCAGCAAGGAGCTGCGCTGCAT
GATGTTCGGATTCGGAGACGACAAAAATCCATACACGGAAACCGTAGATC
TGTTGGAAGACCTGGTCATTGAGTATATAGCTGAGACCACTCACCGGGCA
ATGGAGATCGGTCGAACAGGCCGTGTTCAAGTCGAAGACATTATCTTCCT
GGTGCGCAAAGATCCCCGAAAGTACGCTAGGGTGAAGGATCTTCTGACCA
TGAACGAGGAGTTGAAAAAGGCACGAAAGGCCTTCGATGAGATCAAGTAT
GTGGGCACCGAAGGCAAGCTCAAAGCAAGCTTTCTAGACCAT

BO01406.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
Taf13-RA 411 CG10756-PA 1..408 17..424 2025 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
Taf13-RA 628 CG10756-RA 82..489 17..424 2025 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:36:04
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20093317..20093660 405..62 1705 99.7 Minus
2L 23513712 2L 20093724..20093768 61..17 225 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:36:05 has no hits.

BO01406.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:29 Download gff for BO01406.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 1..411 17..427 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:17 Download gff for BO01406.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 73..493 10..430 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:43 Download gff for BO01406.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 82..489 17..426 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:29 Download gff for BO01406.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 73..493 10..430 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:51:36 Download gff for BO01406.complete
Subject Subject Range Query Range Percent Splice Strand
Taf13-RA 82..489 17..426 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:51:36 Download gff for BO01406.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20093724..20093768 17..61 100   Minus
2L 20093318..20093660 62..404 99 <- Minus
2L 20093223..20093246 405..426 91 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:43 Download gff for BO01406.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20093724..20093768 17..61 100   Minus
arm_2L 20093318..20093660 62..404 99 <- Minus
arm_2L 20093223..20093246 405..426 91 <- Minus

BO01406.pep Sequence

Translation from 16 to 442

> BO01406.pep
MASNSMPEENFEGGDFNFDDDAEDDQFVATNSGRKRLFSKELRCMMFGFG
DDKNPYTETVDLLEDLVIEYIAETTHRAMEIGRTGRVQVEDIIFLVRKDP
RKYARVKDLLTMNEELKKARKAFDEIKYVGTEGKLKASFLDH

BO01406.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Taf13-PA 136 CG10756-PA 1..136 1..136 703 100 Plus