Clone BO01412 Report

Search the DGRC for BO01412

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptRYBP-RA
Protein status:BO01412.pep:
Sequenced Size:484

Clone Sequence Records

BO01412.5prime Sequence

482 bp (481 high quality bases) assembled on 2005-11-30

> BO01412.5prime
GAAGTTATCAGTCGACATGGACAAGAAATCCTCGCCGGTGCGACGACAAA
AGCGGCAGGCGAAGGTGATCGAGGAGAACTTCTGGGACTGCAGCGTCTGC
ACATATAGAAACTCGGCGGAGGCCTTCAAGTGTCGCATGTGCGACGTGCG
GAAAGGAACCTCCACGCGAAAGCCACGCCTGAACTCAGCGCTAGTCGCCC
AGCAGGCCGCCACTTTGCCAGGAGCCAGTGTCAACATGCCCAACGGGAAG
TCCGCCTCCGGATCACGGCATGGCAGTGGGCACGACCGGCAGAGGCACAA
GCGGTATCCGGCACGGTTGAAAAACGTGGACCGATCGACGGCACAGACGC
GAGAGGTGACGGTCAACTCGGTGACCGTGTTCATCACAGAGTACAAGGCC
AAGCCGGTGAGCAGCCGACGCGAATCCAGTGAGCAGAGCTTCAGCGAGAG
CAACGACAGCCGGAGTGCAAGCTTTCTAGACC

BO01412.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG12190-PA 453 CG12190-RA 1..450 17..466 2250 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
RYBP-RB 2242 CG12190-RB 521..970 17..466 2250 100 Plus
RYBP-RA 2064 CG12190-RA 343..792 17..466 2250 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22671628..22671940 154..466 1565 100 Plus
2R 25286936 2R 22671107..22671246 17..156 700 100 Plus
Blast to na_te.dros performed on 2015-02-10 15:37:08 has no hits.

BO01412.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:42 Download gff for BO01412.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12190-PA 1..453 17..467 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:17 Download gff for BO01412.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12190-PA 1..453 17..467 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 02:34:40 Download gff for BO01412.5prime
Subject Subject Range Query Range Percent Splice Strand
RYBP-RA 356..810 11..466 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:16:35 Download gff for BO01412.5prime
Subject Subject Range Query Range Percent Splice Strand
RYBP-RA 338..792 11..466 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:16:35 Download gff for BO01412.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 22671630..22671940 156..466 100   Plus
2R 22671102..22671245 11..155 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 02:34:40 Download gff for BO01412.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18559135..18559445 156..466 100   Plus
arm_2R 18558607..18558750 11..155 97 -> Plus

BO01412.3prime Sequence

482 bp (481 high quality bases) assembled on 2005-11-30

> BO01412.3prime
ATGGTCTAGAAAGCTTGCACTCCGGCTGTCGTTGCTCTCGCTGAAGCTCT
GCTCACTGGATTCGCGTCGGCTGCTCACCGGCTTGGCCTTGTACTCTGTG
ATGAACACGGTCACCGAGTTGACCGTCACCTCTCGCGTCTGTGCCGTCGA
TCGGTCCACGTTTTTCAACCGTGCCGGATACCGCTTGTGCCTCTGCCGGT
CGTGCCCACTGCCATGCCGTGATCCGGAGGCGGACTTCCCGTTGGGCATG
TTGACACTGGCTCCTGGCAAAGTGGCGGCCTGCTGGGCGACTAGCGCTGA
GTTCAGGCGTGGCTTTCGCGTGGAGGTTCCTTTCCGCACGTCGCACATGC
GACACTTGAAGGCCTCCGCCGAGTTTCTATATGTGCAGACGCTGCAGTCC
CAGAAGTTCTCCTCGATCACCTTCGCCTGCCGCTTTTGTCGTCGCACCGG
CGAGGATTTCTTGTCCATGTCGACTGATAACT

BO01412.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG12190-PA 453 CG12190-RA 1..450 468..19 2250 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:14:04
Subject Length Description Subject Range Query Range Score Percent Strand
RYBP-RB 2242 CG12190-RB 521..970 468..19 2250 100 Minus
RYBP-RA 2064 CG12190-RA 343..792 468..19 2250 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22671628..22671940 331..19 1565 100 Minus
2R 25286936 2R 22671107..22671246 468..329 700 100 Minus
Blast to na_te.dros performed on 2015-02-13 16:14:03 has no hits.

BO01412.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:41 Download gff for BO01412.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12190-PA 1..453 18..468 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:15 Download gff for BO01412.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12190-PA 1..453 18..468 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:57:08 Download gff for BO01412.3prime
Subject Subject Range Query Range Percent Splice Strand
RYBP-RA 356..810 19..474 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:48:26 Download gff for BO01412.3prime
Subject Subject Range Query Range Percent Splice Strand
RYBP-RA 338..792 19..474 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:48:26 Download gff for BO01412.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 22671630..22671940 19..329 100   Minus
2R 22671102..22671245 330..474 97 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:57:08 Download gff for BO01412.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18559135..18559445 19..329 100   Minus
arm_2R 18558607..18558750 330..474 97 -> Minus

BO01412.complete Sequence

484 bp (484 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629488

> BO01412.complete
GAAGTTATCAGTCGACATGGACAAGAAATCCTCGCCGGTGCGACGACAAA
AGCGGCAGGCGAAGGTGATCGAGGAGAACTTCTGGGACTGCAGCGTCTGC
ACATATAGAAACTCGGCGGAGGCCTTCAAGTGTCGCATGTGCGACGTGCG
GAAAGGAACCTCCACGCGAAAGCCACGCCTGAACTCAGCGCTAGTCGCCC
AGCAGGCCGCCACTTTGCCAGGAGCCAGTGTCAACATGCCCAACGGGAAG
TCCGCCTCCGGATCACGGCATGGCAGTGGGCACGACCGGCAGAGGCACAA
GCGGTATCCGGCACGGTTGAAAAACGTGGACCGATCGACGGCACAGACGC
GAGAGGTGACGGTCAACTCGGTGACCGTGTTCATCACAGAGTACAAGGCC
AAGCCGGTGAGCAGCCGACGCGAATCCAGTGAGCAGAGCTTCAGCGAGAG
CAACGACAGCCGGAGTGCAAGCTTTCTAGACCAT

BO01412.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
RYBP-RB 453 CG12190-PB 1..450 17..466 2250 100 Plus
RYBP-RA 453 CG12190-PA 1..450 17..466 2250 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
RYBP-RB 2242 CG12190-RB 521..970 17..466 2250 100 Plus
RYBP-RA 2064 CG12190-RA 343..792 17..466 2250 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22671628..22671940 154..466 1565 100 Plus
2R 25286936 2R 22671107..22671246 17..156 700 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:40:53 has no hits.

BO01412.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:33 Download gff for BO01412.complete
Subject Subject Range Query Range Percent Splice Strand
CG12190-RA 1..453 17..467 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:21 Download gff for BO01412.complete
Subject Subject Range Query Range Percent Splice Strand
CG12190-RA 351..805 11..466 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:44:36 Download gff for BO01412.complete
Subject Subject Range Query Range Percent Splice Strand
RYBP-RA 361..810 17..468 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:33 Download gff for BO01412.complete
Subject Subject Range Query Range Percent Splice Strand
CG12190-RA 351..805 11..466 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:13:44 Download gff for BO01412.complete
Subject Subject Range Query Range Percent Splice Strand
RYBP-RA 343..792 17..468 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:13:44 Download gff for BO01412.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22671630..22671940 156..468 99   Plus
2R 22671107..22671245 17..155 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:44:36 Download gff for BO01412.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18559135..18559445 156..468 99   Plus
arm_2R 18558612..18558750 17..155 100 -> Plus

BO01412.pep Sequence

Translation from 16 to 484

> BO01412.pep
MDKKSSPVRRQKRQAKVIEENFWDCSVCTYRNSAEAFKCRMCDVRKGTST
RKPRLNSALVAQQAATLPGASVNMPNGKSASGSRHGSGHDRQRHKRYPAR
LKNVDRSTAQTREVTVNSVTVFITEYKAKPVSSRRESSEQSFSESNDSRS
ASFLDH

BO01412.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
RYBP-PB 150 CG12190-PB 1..150 1..150 771 100 Plus
RYBP-PA 150 CG12190-PA 1..150 1..150 771 100 Plus