Clone BO01414 Report

Search the DGRC for BO01414

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:14
Vector:pDNR-Dual
Associated Gene/TranscriptNf-YB-RA
Protein status:BO01414.pep:
Sequenced Size:502

Clone Sequence Records

BO01414.3prime Sequence

500 bp (499 high quality bases) assembled on 2005-11-30

> BO01414.3prime
ATGGTCTAGAAAGCTTGCCTGTTTCCCCGCATCGTTTGCGGAGGACCCAT
CTTCGTTGTGCGGATAACTGGCGTCCAGAAAGAGATTACGATCCGATTTG
TTCGACTCTCGGTACTTTTGCAGGTAAATGGACAGTGGTTCCACGTAATT
GTCGAATCCCAGATTGCTGAACGCCACCAGCAGGTCGTCCCCGTTGACTG
TCTTGCGATTCTCCGCGACGCTACGTTCGATGGCCTCACTGCTAATGAAG
GATATGAACTCGGAGACACACTCCTGGATGCACTCTCGTGCATCCTTGGC
TATCTTGCCGTTCTGGGGCACCGGAACCTTCATGATCTTAATGATGTTGC
AGATGGGCAGAAATCGGTCCTGTTCGCGTAGCATTATCCCTCCATCCTGT
TTGTCCGAATCGTCGCCGGACGCCTCGTCCTCCTCCTTGACCAGCATGTC
GTTCAGATACTGCTGCGAGTCCTCGCTATTGCTCATGTCGACTGATAACT

BO01414.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG10447-PA 471 CG10447-RA 1..468 486..19 2340 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YB-RB 796 CG10447-RB 93..560 486..19 2340 100 Minus
Nf-YB-RA 928 CG10447-RA 93..560 486..19 2340 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19736272..19736580 414..106 1545 100 Minus
2L 23513712 2L 19736632..19736720 107..19 445 100 Minus
2L 23513712 2L 19736136..19736208 486..414 365 100 Minus
Blast to na_te.dros performed 2015-02-12 10:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
G5 4856 G5 G5_DM 4856bp 583..664 389..472 135 65.5 Plus

BO01414.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:44 Download gff for BO01414.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10447-PA 1..471 15..486 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:21 Download gff for BO01414.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10447-PA 1..471 15..486 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:48:31 Download gff for BO01414.3prime
Subject Subject Range Query Range Percent Splice Strand
Nf-YB-RA 87..563 15..494 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:04:07 Download gff for BO01414.3prime
Subject Subject Range Query Range Percent Splice Strand
Nf-YB-RA 87..563 15..494 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:04:07 Download gff for BO01414.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 19736634..19736723 15..105 97   Minus
2L 19736273..19736580 106..413 100 -> Minus
2L 19736141..19736208 414..481 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:48:31 Download gff for BO01414.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19736634..19736723 15..105 97   Minus
arm_2L 19736273..19736580 106..413 100 -> Minus
arm_2L 19736141..19736208 414..481 100 -> Minus

BO01414.5prime Sequence

500 bp (499 high quality bases) assembled on 2005-11-30

> BO01414.5prime
GAAGTTATCAGTCGACATGAGCAATAGCGAGGACTCGCAGCAGTATCTGA
ACGACATGCTGGTCAAGGAGGAGGACGAGGCGTCCGGCGACGATTCGGAC
AAACAGGATGGAGGGATAATGCTACGCGAACAGGACCGATTTCTGCCCAT
CTGCAACATCATTAAGATCATGAAGGTTCCGGTGCCCCAGAACGGCAAGA
TAGCCAAGGATGCACGAGAGTGCATCCAGGAGTGTGTCTCCGAGTTCATA
TCCTTCATTAGCAGTGAGGCCATCGAACGTAGCGTCGCGGAGAATCGCAA
GACAGTCAACGGGGACGACCTGCTGGTGGCGTTCAGCAATCTGGGATTCG
ACAATTACGTGGAACCACTGTCCATTTACCTGCAAAAGTACCGAGAGTCG
AACAAATCGGATCGTAATCTCTTTCTGGACGCCAGTTATCCGCACAACGA
AGATGGGTCCTCCGCAAACGATGCGGGGAAACAGGCAAGCTTTCTAGACC

BO01414.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG10447-PA 471 CG10447-RA 1..468 17..484 2340 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YB-RB 796 CG10447-RB 93..560 17..484 2340 100 Plus
Nf-YB-RA 928 CG10447-RA 93..560 17..484 2340 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19736272..19736580 89..397 1545 100 Plus
2L 23513712 2L 19736632..19736720 396..484 445 100 Plus
2L 23513712 2L 19736136..19736208 17..89 365 100 Plus
Blast to na_te.dros performed 2015-02-12 00:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
G5 4856 G5 G5_DM 4856bp 583..664 114..31 135 65.5 Minus

BO01414.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:45 Download gff for BO01414.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10447-PA 1..471 17..488 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:22 Download gff for BO01414.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10447-PA 1..471 17..488 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:33:00 Download gff for BO01414.5prime
Subject Subject Range Query Range Percent Splice Strand
Nf-YB-RA 87..563 9..488 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:19:27 Download gff for BO01414.5prime
Subject Subject Range Query Range Percent Splice Strand
Nf-YB-RA 87..563 9..488 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:19:27 Download gff for BO01414.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 19736634..19736723 398..488 97   Plus
2L 19736273..19736580 90..397 100 -> Plus
2L 19736141..19736208 22..89 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:33:00 Download gff for BO01414.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19736634..19736723 398..488 97   Plus
arm_2L 19736273..19736580 90..397 100 -> Plus
arm_2L 19736141..19736208 22..89 100 -> Plus

BO01414.complete Sequence

502 bp (502 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629489

> BO01414.complete
GAAGTTATCAGTCGACATGAGCAATAGCGAGGACTCGCAGCAGTATCTGA
ACGACATGCTGGTCAAGGAGGAGGACGAGGCGTCCGGCGACGATTCGGAC
AAACAGGATGGAGGGATAATGCTACGCGAACAGGACCGATTTCTGCCCAT
CTGCAACATCATTAAGATCATGAAGGTTCCGGTGCCCCAGAACGGCAAGA
TAGCCAAGGATGCACGAGAGTGCATCCAGGAGTGTGTCTCCGAGTTCATA
TCCTTCATTAGCAGTGAGGCCATCGAACGTAGCGTCGCGGAGAATCGCAA
GACAGTCAACGGGGACGACCTGCTGGTGGCGTTCAGCAATCTGGGATTCG
ACAATTACGTGGAACCACTGTCCATTTACCTGCAAAAGTACCGAGAGTCG
AACAAATCGGATCGTAATCTCTTTCTGGACGCCAGTTATCCGCACAACGA
AGATGGGTCCTCCGCAAACGATGCGGGGAAACAGGCAAGCTTTCTAGACC
AT

BO01414.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YB-RB 471 CG10447-PB 1..468 17..484 2340 100 Plus
Nf-YB-RA 471 CG10447-PA 1..468 17..484 2340 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YB-RB 796 CG10447-RB 93..560 17..484 2340 100 Plus
Nf-YB-RA 928 CG10447-RA 93..560 17..484 2340 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19736272..19736580 89..397 1545 100 Plus
2L 23513712 2L 19736632..19736720 396..484 445 100 Plus
2L 23513712 2L 19736136..19736208 17..89 365 100 Plus
Blast to na_te.dros performed 2014-11-27 20:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
G5 4856 G5 G5_DM 4856bp 583..664 114..31 135 65.5 Minus

BO01414.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:34 Download gff for BO01414.complete
Subject Subject Range Query Range Percent Splice Strand
CG10447-RA 1..471 17..488 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:22 Download gff for BO01414.complete
Subject Subject Range Query Range Percent Splice Strand
CG10447-RA 76..552 9..488 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:07:07 Download gff for BO01414.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YB-RA 93..560 17..486 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:34 Download gff for BO01414.complete
Subject Subject Range Query Range Percent Splice Strand
CG10447-RA 76..552 9..488 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:20:24 Download gff for BO01414.complete
Subject Subject Range Query Range Percent Splice Strand
Nf-YB-RA 93..560 17..486 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:20:24 Download gff for BO01414.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19736634..19736720 398..486 97   Plus
2L 19736273..19736580 90..397 100 -> Plus
2L 19736136..19736208 17..89 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:07:07 Download gff for BO01414.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19736634..19736720 398..486 97   Plus
arm_2L 19736273..19736580 90..397 100 -> Plus
arm_2L 19736136..19736208 17..89 100 -> Plus

BO01414.pep Sequence

Translation from 16 to 502

> BO01414.pep
MSNSEDSQQYLNDMLVKEEDEASGDDSDKQDGGIMLREQDRFLPICNIIK
IMKVPVPQNGKIAKDARECIQECVSEFISFISSEAIERSVAENRKTVNGD
DLLVAFSNLGFDNYVEPLSIYLQKYRESNKSDRNLFLDASYPHNEDGSSA
NDAGKQASFLDH

BO01414.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
Nf-YB-PB 156 CG10447-PB 1..156 1..156 801 100 Plus
Nf-YB-PA 156 CG10447-PA 1..156 1..156 801 100 Plus
NC2beta-PA 183 CG4185-PA 20..103 43..127 142 41.2 Plus