Clone BO01416 Report

Search the DGRC for BO01416

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:16
Vector:pDNR-Dual
Associated Gene/TranscriptTaf10-RA
Protein status:BO01416.pep: full length peptide match
Sequenced Size:535

Clone Sequence Records

BO01416.3prime Sequence

533 bp (532 high quality bases) assembled on 2005-11-30

> BO01416.3prime
ATGGTCTAGAAAGCTTGCAACGAAATACTGCGGCTTGCGCATGGTGATGC
CGTGGTCCGCGAGTGCCGGCACCAGGTCCTCCATGGCCAGCGTGTACTTC
CTGTCCTTGGGGTTTTTCTTGTCCTTGCTGGAACTGTGTCCGCTGGAATG
CTGGATGTTCGTGGTGCGCGTCTTGCAGTGCTGCAGTGCGTCGTTGGCAA
TATCCGAGATGAACTTCTGCGCGGACACCGAGACGAGGCGCACTATCTTG
GGGTCCACTGTGCAGAAGCCAGCCGTTTTCAAGATGTGCATGGTGAGGGC
GTCTGGTATGGTGGGCGAGTAGTCCTCCAGCTGCTTTATCAGCTCATCCA
TCTCCGATTCCTCCGTCGTCAGAGGAACCTCCTCCACGTCCGGTTGCTCC
TCGTCGGAATGCAGTTCGGACTGCATTAGTGGCGAGTCTATATCCTCCTC
CTCGGTGTCCGTGGCCGATGTTACGGATTCTGCGGGTGTAACACTGATGT
CCTCGCCATCGGAAGCCATGTCGACTGATAACT

BO01416.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG2859-PA 504 Taf10-RA 1..501 519..19 2505 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
Taf10-RA 664 CG2859-RA 92..592 519..19 2505 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2768285..2768540 274..19 1280 100 Minus
2L 23513712 2L 2767981..2768227 519..273 1235 100 Minus
Blast to na_te.dros performed 2015-02-12 00:30:50
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 4126..4175 439..390 106 68 Minus

BO01416.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:48 Download gff for BO01416.3prime
Subject Subject Range Query Range Percent Splice Strand
Taf10-PA 1..504 18..519 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:27 Download gff for BO01416.3prime
Subject Subject Range Query Range Percent Splice Strand
CG2859-PA 1..504 18..519 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:31:53 Download gff for BO01416.3prime
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 92..599 10..519 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:02:19 Download gff for BO01416.3prime
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 92..599 10..519 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:02:19 Download gff for BO01416.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 2768286..2768547 10..273 98   Minus
2L 2767981..2768226 274..519 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:31:53 Download gff for BO01416.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2768286..2768547 10..273 98   Minus
arm_2L 2767981..2768226 274..519 100 -> Minus

BO01416.5prime Sequence

533 bp (532 high quality bases) assembled on 2005-11-30

> BO01416.5prime
GAAGTTATCAGTCGACATGGCTTCCGATGGCGAGGACATCAGTGTTACAC
CCGCAGAATCCGTAACATCGGCCACGGACACCGAGGAGGAGGATATAGAC
TCGCCACTAATGCAGTCCGAACTGCATTCCGACGAGGAGCAACCGGACGT
GGAGGAGGTTCCTCTGACGACGGAGGAATCGGAGATGGATGAGCTGATAA
AGCAGCTGGAGGACTACTCGCCCACCATACCAGACGCCCTCACCATGCAC
ATCTTGAAAACGGCTGGCTTCTGCACAGTGGACCCCAAGATAGTGCGCCT
CGTCTCGGTGTCCGCGCAGAAGTTCATCTCGGATATTGCCAACGACGCAC
TGCAGCACTGCAAGACGCGCACCACGAACATCCAGCATTCCAGCGGACAC
AGTTCCAGCAAGGACAAGAAAAACCCCAAGGACAGGAAGTACACGCTGGC
CATGGAGGACCTGGTGCCGGCACTCGCGGACCACGGCATCACCATGCGCA
AGCCGCAGTATTTCGTTGCAAGCTTTCTAGACC

BO01416.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG2859-PA 504 Taf10-RA 1..501 17..517 2505 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:14:09
Subject Length Description Subject Range Query Range Score Percent Strand
Taf10-RA 664 CG2859-RA 92..592 17..517 2505 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:14:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2768285..2768540 262..517 1280 100 Plus
2L 23513712 2L 2767981..2768227 17..263 1235 100 Plus
Blast to na_te.dros performed 2015-02-13 16:14:07
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 4126..4175 97..146 106 68 Plus

BO01416.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:49 Download gff for BO01416.5prime
Subject Subject Range Query Range Percent Splice Strand
Taf10-PA 1..504 17..518 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:28 Download gff for BO01416.5prime
Subject Subject Range Query Range Percent Splice Strand
CG2859-PA 1..504 17..518 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:57:10 Download gff for BO01416.5prime
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 92..599 17..526 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:48:38 Download gff for BO01416.5prime
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 92..599 17..526 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:48:38 Download gff for BO01416.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 2768286..2768547 263..526 98   Plus
2L 2767981..2768226 17..262 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:57:10 Download gff for BO01416.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2768286..2768547 263..526 98   Plus
arm_2L 2767981..2768226 17..262 100 -> Plus

BO01416.complete Sequence

535 bp (535 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629490

> BO01416.complete
GAAGTTATCAGTCGACATGGCTTCCGATGGCGAGGACATCAGTGTTACAC
CCGCAGAATCCGTAACATCGGCCACGGACACCGAGGAGGAGGATATAGAC
TCGCCACTAATGCAGTCCGAACTGCATTCCGACGAGGAGCAACCGGACGT
GGAGGAGGTTCCTCTGACGACGGAGGAATCGGAGATGGATGAGCTGATAA
AGCAGCTGGAGGACTACTCGCCCACCATACCAGACGCCCTCACCATGCAC
ATCTTGAAAACGGCTGGCTTCTGCACAGTGGACCCCAAGATAGTGCGCCT
CGTCTCGGTGTCCGCGCAGAAGTTCATCTCGGATATTGCCAACGACGCAC
TGCAGCACTGCAAGACGCGCACCACGAACATCCAGCATTCCAGCGGACAC
AGTTCCAGCAAGGACAAGAAAAACCCCAAGGACAGGAAGTACACGCTGGC
CATGGAGGACCTGGTGCCGGCACTCGCGGACCACGGCATCACCATGCGCA
AGCCGCAGTATTTCGTTGCAAGCTTTCTAGACCAT

BO01416.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
Taf10-RA 504 CG2859-PA 1..501 17..517 2505 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
Taf10-RA 664 CG2859-RA 92..592 17..517 2505 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:52:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2768285..2768540 262..517 1280 100 Plus
2L 23513712 2L 2767981..2768227 17..263 1235 100 Plus
Blast to na_te.dros performed 2014-11-27 16:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 4126..4175 97..146 106 68 Plus

BO01416.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:36 Download gff for BO01416.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 1..504 17..518 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:25 Download gff for BO01416.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 70..577 17..526 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:00:11 Download gff for BO01416.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 92..592 17..519 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:36 Download gff for BO01416.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 70..577 17..526 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:29:19 Download gff for BO01416.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10-RA 92..592 17..519 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:29:19 Download gff for BO01416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2768286..2768540 263..519 99   Plus
2L 2767981..2768226 17..262 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:00:11 Download gff for BO01416.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2768286..2768540 263..519 99   Plus
arm_2L 2767981..2768226 17..262 100 -> Plus

BO01416.pep Sequence

Translation from 16 to 535

> BO01416.pep
MASDGEDISVTPAESVTSATDTEEEDIDSPLMQSELHSDEEQPDVEEVPL
TTEESEMDELIKQLEDYSPTIPDALTMHILKTAGFCTVDPKIVRLVSVSA
QKFISDIANDALQHCKTRTTNIQHSSGHSSSKDKKNPKDRKYTLAMEDLV
PALADHGITMRKPQYFVASFLDH

BO01416.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:30:25
Subject Length Description Subject Range Query Range Score Percent Strand
Taf10-PA 167 CG2859-PA 1..167 1..167 854 100 Plus
Taf10b-PA 146 CG3069-PA 35..144 51..165 289 53 Plus