Clone BO01422 Report

Search the DGRC for BO01422

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:22
Vector:pDNR-Dual
Associated Gene/TranscriptFer3-RA
Protein status:BO01422.pep: full length peptide match
Sequenced Size:619

Clone Sequence Records

BO01422.3prime Sequence

617 bp (616 high quality bases) assembled on 2005-11-30

> BO01422.3prime
ATGGTCTAGAAAGCTTGCGGACAAACTATGATTATAGGGCGAAGCGAAAT
CGCGTTGATATGCCGCCGCCGGATGCAGATGATGTGGATGAATTGCCGGT
GGTGGCGCCTGATGGTGACCATTCATACTCCCATAGACGTCGGACCGCGA
TTTGTGGGAGTTCGAGGGCGTGCCGCTCAGCAGCTCAGCCATGAATCCGA
TGTAGGTGATGGCCAAGCGAAGGGTTTCGATGCGGGACAGTCGTTTCTCG
TAGGCGAAGGTGGGCACCTTGCGGCGCAACTTGTCGAAGGCCTCGTTTAG
GTTAAACATGCGACGGCGTTCGCGGATATTTGCAGCTCTCCGTTGGGCCA
TTGATGCCACACGGCGACGCGTTTTCTTCGAGGAGCTGGAGGAGCCGTTG
GCCCTCCCATTTGTCGACGGACGCTGGGGCACCAAAGGAGTTACTTGCGA
GCGCTGCCACAGAGACAAGTCGGTGCAGGGAAAACCGGCGATGAGCTCTT
GGTATGGAACAATGGGCGGCGGTGGAGCCTCCTGACCCCAAAGCGGCTGG
AATGGAACATCCGGCATGTAGGTGGGCTGGTCAATGGGATGTGGATGCTG
CATGTCGACTGATAACT

BO01422.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG6913-PA 588 Fer3-RA 1..585 603..19 2925 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
Fer3-RA 836 CG6913-RA 85..670 604..19 2930 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11693576..11694021 19..464 2230 100 Plus
3R 32079331 3R 11694088..11694227 465..604 700 100 Plus
Blast to na_te.dros performed on 2015-02-11 15:41:39 has no hits.

BO01422.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:53 Download gff for BO01422.3prime
Subject Subject Range Query Range Percent Splice Strand
Fer3-PA 1..588 18..603 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:36 Download gff for BO01422.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6913-PA 1..588 18..603 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:48:04 Download gff for BO01422.3prime
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 81..670 19..611 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:12:17 Download gff for BO01422.3prime
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 81..670 19..611 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:12:17 Download gff for BO01422.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 11694088..11694231 465..611 97   Plus
3R 11693576..11694021 19..464 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:48:04 Download gff for BO01422.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7519810..7519953 465..611 97   Plus
arm_3R 7519298..7519743 19..464 100 <- Plus

BO01422.5prime Sequence

617 bp (616 high quality bases) assembled on 2005-11-30

> BO01422.5prime
GAAGTTATCAGTCGACATGCAGCATCCACATCCCATTGACCAGCCCACCT
ACATGCCGGATGTTCCATTCCAGCCGCTTTGGGGTCAGGAGGCTCCACCG
CCGCCCATTGTTCCATACCAAGAGCTCATCGCCGGTTTTCCCTGCACCGA
CTTGTCTCTGTGGCAGCGCTCGCAAGTAACTCCTTTGGTGCCCCAGCGTC
CGTCGACAAATGGGAGGGCCAACGGCTCCTCCAGCTCCTCGAAGAAAACG
CGTCGCCGTGTGGCATCAATGGCCCAACGGAGAGCTGCAAATATCCGCGA
ACGCCGTCGCATGTTTAACCTAAACGAGGCCTTCGACAAGTTGCGCCGCA
AGGTGCCCACCTTCGCCTACGAGAAACGACTGTCCCGCATCGAAACCCTT
CGCTTGGCCATCACCTACATCGGATTCATGGCTGAGCTGCTGAGCGGCAC
GCCCTCGAACTCCCACAAATCGCGGTCCGACGTCTATGGGAGTATGAATG
GTCACCATCAGGCGCCACCACCGGCAATTCATCCACATCATCTGCATCCG
GCGGCGGCATATCAACGCGATTTCGCTTCGCCCTATAATCATAGTTTGTC
CGCAAGCTTTCTAGACC

BO01422.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG6913-PA 588 Fer3-RA 1..585 17..601 2925 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:04:21
Subject Length Description Subject Range Query Range Score Percent Strand
Fer3-RA 836 CG6913-RA 85..670 16..601 2930 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11693576..11694021 601..156 2230 100 Minus
3R 32079331 3R 11694088..11694227 155..16 700 100 Minus
Blast to na_te.dros performed on 2015-02-12 16:04:20 has no hits.

BO01422.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:54 Download gff for BO01422.5prime
Subject Subject Range Query Range Percent Splice Strand
Fer3-PA 1..588 17..602 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:37 Download gff for BO01422.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6913-PA 1..588 17..602 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:24:21 Download gff for BO01422.5prime
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 81..670 9..601 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:39:53 Download gff for BO01422.5prime
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 81..670 9..601 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:39:53 Download gff for BO01422.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 11694088..11694231 9..155 97   Minus
3R 11693576..11694021 156..601 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:24:21 Download gff for BO01422.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7519810..7519953 9..155 97   Minus
arm_3R 7519298..7519743 156..601 100 <- Minus

BO01422.complete Sequence

619 bp (619 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629491

> BO01422.complete
GAAGTTATCAGTCGACATGCAGCATCCACATCCCATTGACCAGCCCACCT
ACATGCCGGATGTTCCATTCCAGCCGCTTTGGGGTCAGGAGGCTCCACCG
CCGCCCATTGTTCCATACCAAGAGCTCATCGCCGGTTTTCCCTGCACCGA
CTTGTCTCTGTGGCAGCGCTCGCAAGTAACTCCTTTGGTGCCCCAGCGTC
CGTCGACAAATGGGAGGGCCAACGGCTCCTCCAGCTCCTCGAAGAAAACG
CGTCGCCGTGTGGCATCAATGGCCCAACGGAGAGCTGCAAATATCCGCGA
ACGCCGTCGCATGTTTAACCTAAACGAGGCCTTCGACAAGTTGCGCCGCA
AGGTGCCCACCTTCGCCTACGAGAAACGACTGTCCCGCATCGAAACCCTT
CGCTTGGCCATCACCTACATCGGATTCATGGCTGAGCTGCTGAGCGGCAC
GCCCTCGAACTCCCACAAATCGCGGTCCGACGTCTATGGGAGTATGAATG
GTCACCATCAGGCGCCACCACCGGCAATTCATCCACATCATCTGCATCCG
GCGGCGGCATATCAACGCGATTTCGCTTCGCCCTATAATCATAGTTTGTC
CGCAAGCTTTCTAGACCAT

BO01422.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
Fer3-RA 588 CG6913-PA 1..585 17..601 2925 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
Fer3-RA 836 CG6913-RA 85..670 16..601 2930 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11693576..11694021 601..156 2230 100 Minus
3R 32079331 3R 11694088..11694227 155..16 700 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:14:56 has no hits.

BO01422.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:37 Download gff for BO01422.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 1..588 17..602 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:26 Download gff for BO01422.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 47..636 9..601 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:38:54 Download gff for BO01422.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 86..670 17..603 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:37 Download gff for BO01422.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 47..636 9..601 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:03:16 Download gff for BO01422.complete
Subject Subject Range Query Range Percent Splice Strand
Fer3-RA 86..670 17..603 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:03:16 Download gff for BO01422.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11694088..11694226 17..155 100   Minus
3R 11693574..11694021 156..603 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:38:54 Download gff for BO01422.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7519810..7519948 17..155 100   Minus
arm_3R 7519296..7519743 156..603 99 <- Minus

BO01422.pep Sequence

Translation from 16 to 619

> BO01422.pep
MQHPHPIDQPTYMPDVPFQPLWGQEAPPPPIVPYQELIAGFPCTDLSLWQ
RSQVTPLVPQRPSTNGRANGSSSSSKKTRRRVASMAQRRAANIRERRRMF
NLNEAFDKLRRKVPTFAYEKRLSRIETLRLAITYIGFMAELLSGTPSNSH
KSRSDVYGSMNGHHQAPPPAIHPHHLHPAAAYQRDFASPYNHSLSASFLD
H

BO01422.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:30:24
Subject Length Description Subject Range Query Range Score Percent Strand
Fer3-PA 195 CG6913-PA 1..195 1..195 1045 100 Plus
Fer1-PA 251 CG33323-PA 55..159 69..169 198 41.8 Plus
Fer1-PB 256 CG33323-PB 69..164 71..169 197 44.6 Plus
Fer2-PE 273 CG5952-PE 122..204 63..142 177 50.6 Plus
Fer2-PB 274 CG5952-PB 122..204 63..142 177 50.6 Plus