Clone BO01424 Report

Search the DGRC for BO01424

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:24
Vector:pDNR-Dual
Associated Gene/Transcriptemc-RA
Protein status:BO01424.pep: full length peptide match
Sequenced Size:631

Clone Sequence Records

BO01424.3prime Sequence

629 bp (628 high quality bases) assembled on 2005-11-30

> BO01424.3prime
ATGGTCTAGAAAGCTTGCCGACTGTCTGCTGTCTTTCTCCGCATTCTGTG
GCGTTGCTAAACTGTTGGACAGTTGCTGCTGTGATTGCAGTTGTTGCTGC
TGCAGTTGCAGTTGCTGCTGCTGCTGATGCTGCTGCGGATGGGCGGGCGC
CACAAGAGTGTTGGGCGTTTGGCGATCGGTAAGCGGGAGACGGGCGGCGG
GACTAGAGACTTTCGCCGGCTGCTCGGCATTCAGGCGCTGGGCGAGGATA
TCTGGATCGACTTCCGCTTCTGCCTCGGCATCCGCATCCTCCATGTCGCT
GTCCTCGTCCTCGTGGAGTCCGTTCACCGCCGTCAGAGCGGCTGCCGCAT
CGAAGTTGCCCATCTCGGGGTGCGTCTCCAGCTCGGTCTGCAGGTCGCAG
ATGTAGTCGATGACGTGCTGGATGATCTCCAGCTTGGTGAGCTTCCTGTT
CTTGGGCATGAACGGAACGAGGTCCTTCAGTTTGGACAGATACATCTTCA
TCTCGGCGTTCTCCCCGTCGCCGCGGTGCGTGGGATGGCGCTGGATGCGC
CCGCTGGCATTCAAGGCCGGCATTCCGGAGGCACCTGTCTGGCAGACGGC
CGTCAGGGACTTCATGTCGACTGATAACT

BO01424.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG1007-PA 600 emc-RA 1..597 615..19 2985 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 18:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
emc-RA 2049 CG1007-RA 265..861 615..19 2985 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 18:17:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 749664..750227 615..52 2820 100 Minus
Blast to na_te.dros performed on 2015-02-09 18:17:15 has no hits.

BO01424.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:57 Download gff for BO01424.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1007-PA 1..600 15..615 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:41 Download gff for BO01424.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1007-PA 1..600 15..615 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 03:54:30 Download gff for BO01424.3prime
Subject Subject Range Query Range Percent Splice Strand
emc-RA 261..866 13..623 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:09:40 Download gff for BO01424.3prime
Subject Subject Range Query Range Percent Splice Strand
emc-RA 261..866 13..623 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:09:40 Download gff for BO01424.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 752272..752309 13..51 94   Minus
3L 749660..750227 52..623 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 03:54:30 Download gff for BO01424.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 752272..752309 13..51 94   Minus
arm_3L 749660..750227 52..623 99 -> Minus

BO01424.5prime Sequence

629 bp (628 high quality bases) assembled on 2005-11-30

> BO01424.5prime
GAAGTTATCAGTCGACATGAAGTCCCTGACGGCCGTCTGCCAGACAGGTG
CCTCCGGAATGCCGGCCTTGAATGCCAGCGGGCGCATCCAGCGCCATCCC
ACGCACCGCGGCGACGGGGAGAACGCCGAGATGAAGATGTATCTGTCCAA
ACTGAAGGACCTCGTTCCGTTCATGCCCAAGAACAGGAAGCTCACCAAGC
TGGAGATCATCCAGCACGTCATCGACTACATCTGCGACCTGCAGACCGAG
CTGGAGACGCACCCCGAGATGGGCAACTTCGATGCGGCAGCCGCTCTGAC
GGCGGTGAACGGACTCCACGAGGACGAGGACAGCGACATGGAGGATGCGG
ATGCCGAGGCAGAAGCGGAAGTCGATCCAGATATCCTCGCCCAGCGCCTG
AATGCCGAGCAGCCGGCGAAAGTCTCTAGTCCCGCCGCCCGTCTCCCGCT
TACCGATCGCCAAACGCCCAACACTCTTGTGGCGCCCGCCCATCCGCAGC
AGCATCAGCAGCAGCAGCAACTGCAACTGCAGCAGCAACAACTGCAATCA
CAGCAGCAACTGTCCAACAGTTTAGCAACGCCACAGAATGCGGAGAAAGA
CAGCAGACAGTCGGCAAGCTTTCTAGACC

BO01424.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG1007-PA 600 emc-RA 1..597 17..613 2985 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
emc-RA 2049 CG1007-RA 265..861 17..613 2985 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 749664..750227 17..580 2820 100 Plus
Blast to na_te.dros performed on 2015-02-12 10:20:54 has no hits.

BO01424.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:58 Download gff for BO01424.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1007-PA 1..600 17..617 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:42 Download gff for BO01424.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1007-PA 1..600 17..617 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:48:38 Download gff for BO01424.5prime
Subject Subject Range Query Range Percent Splice Strand
emc-RA 261..866 9..619 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:07:02 Download gff for BO01424.5prime
Subject Subject Range Query Range Percent Splice Strand
emc-RA 261..866 9..619 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:07:02 Download gff for BO01424.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 752272..752309 581..619 94   Plus
3L 749660..750227 9..580 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:48:38 Download gff for BO01424.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 752272..752309 581..619 94   Plus
arm_3L 749660..750227 9..580 99 -> Plus

BO01424.complete Sequence

631 bp (631 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629492

> BO01424.complete
GAAGTTATCAGTCGACATGAAGTCCCTGACGGCCGTCTGCCAGACAGGTG
CCTCCGGAATGCCGGCCTTGAATGCCAGCGGGCGCATCCAGCGCCATCCC
ACGCACCGCGGCGACGGGGAGAACGCCGAGATGAAGATGTATCTGTCCAA
ACTGAAGGACCTCGTTCCGTTCATGCCCAAGAACAGGAAGCTCACCAAGC
TGGAGATCATCCAGCACGTCATCGACTACATCTGCGACCTGCAGACCGAG
CTGGAGACGCACCCCGAGATGGGCAACTTCGATGCGGCAGCCGCTCTGAC
GGCGGTGAACGGACTCCACGAGGACGAGGACAGCGACATGGAGGATGCGG
ATGCCGAGGCAGAAGCGGAAGTCGATCCAGATATCCTCGCCCAGCGCCTG
AATGCCGAGCAGCCGGCGAAAGTCTCTAGTCCCGCCGCCCGTCTCCCGCT
TACCGATCGCCAAACGCCCAACACTCTTGTGGCGCCCGCCCATCCGCAGC
AGCATCAGCAGCAGCAGCAACTGCAACTGCAGCAGCAACAACTGCAATCA
CAGCAGCAACTGTCCAACAGTTTAGCAACGCCACAGAATGCGGAGAAAGA
CAGCAGACAGTCGGCAAGCTTTCTAGACCAT

BO01424.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:00:00
Subject Length Description Subject Range Query Range Score Percent Strand
emc-RA 600 CG1007-PA 1..597 17..613 2985 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:00:01
Subject Length Description Subject Range Query Range Score Percent Strand
emc-RA 2049 CG1007-RA 265..861 17..613 2985 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:59:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 749664..750227 17..580 2820 100 Plus
Blast to na_te.dros performed on 2014-11-27 19:59:59 has no hits.

BO01424.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:13 Download gff for BO01424.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 1..600 17..617 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:01 Download gff for BO01424.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 255..860 9..619 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:05:25 Download gff for BO01424.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 265..861 17..615 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:13 Download gff for BO01424.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 255..860 9..619 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:12:28 Download gff for BO01424.complete
Subject Subject Range Query Range Percent Splice Strand
emc-RA 265..861 17..615 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:12:28 Download gff for BO01424.complete
Subject Subject Range Query Range Percent Splice Strand
3L 752272..752304 581..615 94   Plus
3L 749664..750227 17..580 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:05:25 Download gff for BO01424.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 752272..752304 581..615 94   Plus
arm_3L 749664..750227 17..580 100 -> Plus

BO01424.pep Sequence

Translation from 16 to 631

> BO01424.pep
MKSLTAVCQTGASGMPALNASGRIQRHPTHRGDGENAEMKMYLSKLKDLV
PFMPKNRKLTKLEIIQHVIDYICDLQTELETHPEMGNFDAAAALTAVNGL
HEDEDSDMEDADAEAEAEVDPDILAQRLNAEQPAKVSSPAARLPLTDRQT
PNTLVAPAHPQQHQQQQQLQLQQQQLQSQQQLSNSLATPQNAEKDSRQSA
SFLDH

BO01424.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
emc-PA 199 CG1007-PA 1..199 1..199 1017 100 Plus