Clone BO01427 Report

Search the DGRC for BO01427

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:27
Vector:pDNR-Dual
Associated Gene/Transcriptl(3)73Ah-RA
Protein status:BO01427.pep:
Sequenced Size:700

Clone Sequence Records

BO01427.3prime Sequence

698 bp (697 high quality bases) assembled on 2005-11-30

> BO01427.3prime
ATGGTCTAGAAAGCTTGCGAGCTCGACCCGCGGACGAAACTGCAGCCGAA
GCGGCGGATCCCGGAAGCGCCAGCGCGTCACGTAGACGAACTTCAGCGTG
TGATCCTTGCCGAGCAGCTCCTCGTTGCACAGTATGTCGATCTCTCTGTA
CTTTTCGATGCCGTTGAGGATCTTCTTGGCCACCAGCTTCTTGAGATGCG
TTATCGTCGCCTGCGAGCTGCAGCGAATGAATCGCCTCTGCAGGTTCTTG
AAGTTATTGCTAATGCACTCCAGGCACACGTTCACCTGCTCGTCCAGGCG
ATGGAAGTCGGACTCGGCGTGGGCGTCCATCACCTTCTCGTTGTCGTCCT
CGTGGTTCTGCGTGATATCCTTGGGACACGGCATGTTCCTGCTCTTGTAG
AAGTCCCGCTCTCGGCGCGATTCATCTTCTTGCAGTTTCGGCACCAGTTT
GTACACAATGTCCTGCATGGTGCGATCGAAGCTGATGTATTGCAGGGGAT
GGGACTGATGGATGATGTTGTCGCAGGTGGGGCAGGTCTTCTTCTCCTCC
AGGTGCTTCACCAGGCAACTCTTGCAAAATGTGTGCAGACACTCCGTCAC
CGTGGTGGCATCGATGAAGTAGCCGCCGCAGATCTTGCACGTTATGTGCG
GATTGATCGTCTTCAGCTTCACGCGCCGCTCCATGTCGACTGATAACT

BO01427.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG4195-PA 669 l(3)73Ah-RA 1..666 684..19 3330 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:14:56
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)73Ah-RA 1404 CG4195-RA 377..1043 685..19 3335 100 Minus
l(3)73Ah-RB 1322 CG4195-RB 295..961 685..19 3335 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:14:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16589245..16589530 427..142 1430 100 Minus
3L 28110227 3L 16589016..16589172 582..426 770 99.4 Minus
3L 28110227 3L 16589647..16589771 143..19 625 100 Minus
3L 28110227 3L 16588851..16588957 685..579 535 100 Minus
Blast to na_te.dros performed 2015-02-13 16:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 8763..8803 287..327 115 75.6 Plus

BO01427.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:29:59 Download gff for BO01427.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4195-PA 1..669 15..684 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:44 Download gff for BO01427.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4195-PA 1..669 15..684 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:57:16 Download gff for BO01427.3prime
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RB 295..964 15..685 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:22:49 Download gff for BO01427.3prime
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RB 295..964 15..685 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:22:49 Download gff for BO01427.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 16589649..16589774 15..141 98   Minus
3L 16589247..16589530 142..425 100 -> Minus
3L 16589020..16589172 426..578 100 -> Minus
3L 16588851..16588957 579..685 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:57:16 Download gff for BO01427.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16582749..16582874 15..141 98   Minus
arm_3L 16582347..16582630 142..425 100 -> Minus
arm_3L 16582120..16582272 426..578 100 -> Minus
arm_3L 16581951..16582057 579..685 100 -> Minus

BO01427.5prime Sequence

698 bp (697 high quality bases) assembled on 2005-11-30

> BO01427.5prime
GAAGTTATCAGTCGACATGGAGCGGCGCGTGAAGCTGAAGACGATCAATC
CGCACATAACGTGCAAGATCTGCGGCGGCTACTTCATCGATGCCACCACG
GTGACGGAGTGTCTGCACACATTTTGCAAGAGTTGCCTGGTGAAGCACCT
GGAGGAGAAGAAGACCTGCCCCACCTGCGACAACATCATCCATCAGTCCC
ATCCCCTGCAATACATCAGCTTCGATCGCACCATGCAGGACATTGTGTAC
AAACTGGTGCCGAAACTGCAAGAAGATGAATCGCGCCGAGAGCGGGACTT
CTACAAGAGCAGGAACATGCCGTGTCCCAAGGATATCACGCAGAACCACG
AGGACGACAACGAGAAGGTGATGGACGCCCACGCCGAGTCCGACTTCCAT
CGCCTGGACGAGCAGGTGAACGTGTGCCTGGAGTGCATTAGCAATAACTT
CAAGAACCTGCAGAGGCGATTCATTCGCTGCAGCTCGCAGGCGACGATAA
CGCATCTCAAGAAGCTGGTGGCCAAGAAGATCCTCAACGGCATCGAAAAG
TACAGAGAGATCGACATACTGTGCAACGAGGAGCTGCTCGGCAAGGATCA
CACGCTGAAGTTCGTCTACGTGACGCGCTGGCGCTTCCGGGATCCGCCGC
TTCGGCTGCAGTTTCGTCCGCGGGTCGAGCTCGCAAGCTTTCTAGACC

BO01427.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG4195-PA 669 l(3)73Ah-RA 1..666 17..682 3330 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)73Ah-RA 1404 CG4195-RA 377..1043 16..682 3335 100 Plus
l(3)73Ah-RB 1322 CG4195-RB 295..961 16..682 3335 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:49:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16589245..16589530 274..559 1430 100 Plus
3L 28110227 3L 16589016..16589172 119..275 770 99.4 Plus
3L 28110227 3L 16589647..16589771 558..682 625 100 Plus
3L 28110227 3L 16588851..16588957 16..122 535 100 Plus
Blast to na_te.dros performed 2015-02-12 05:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 8763..8803 414..374 115 75.6 Minus

BO01427.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:00 Download gff for BO01427.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4195-PA 1..669 17..686 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:45 Download gff for BO01427.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4195-PA 1..669 17..686 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:18:09 Download gff for BO01427.5prime
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RB 295..964 16..686 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:55:24 Download gff for BO01427.5prime
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RB 295..964 16..686 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:55:24 Download gff for BO01427.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 16589649..16589774 560..686 98   Plus
3L 16589247..16589530 276..559 100 -> Plus
3L 16589020..16589172 123..275 100 -> Plus
3L 16588851..16588957 16..122 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:18:09 Download gff for BO01427.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16582749..16582874 560..686 98   Plus
arm_3L 16582347..16582630 276..559 100 -> Plus
arm_3L 16582120..16582272 123..275 100 -> Plus
arm_3L 16581951..16582057 16..122 100 -> Plus

BO01427.complete Sequence

700 bp (700 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629493

> BO01427.complete
GAAGTTATCAGTCGACATGGAGCGGCGCGTGAAGCTGAAGACGATCAATC
CGCACATAACGTGCAAGATCTGCGGCGGCTACTTCATCGATGCCACCACG
GTGACGGAGTGTCTGCACACATTTTGCAAGAGTTGCCTGGTGAAGCACCT
GGAGGAGAAGAAGACCTGCCCCACCTGCGACAACATCATCCATCAGTCCC
ATCCCCTGCAATACATCAGCTTCGATCGCACCATGCAGGACATTGTGTAC
AAACTGGTGCCGAAACTGCAAGAAGATGAATCGCGCCGAGAGCGGGACTT
CTACAAGAGCAGGAACATGCCGTGTCCCAAGGATATCACGCAGAACCACG
AGGACGACAACGAGAAGGTGATGGACGCCCACGCCGAGTCCGACTTCCAT
CGCCTGGACGAGCAGGTGAACGTGTGCCTGGAGTGCATTAGCAATAACTT
CAAGAACCTGCAGAGGCGATTCATTCGCTGCAGCTCGCAGGCGACGATAA
CGCATCTCAAGAAGCTGGTGGCCAAGAAGATCCTCAACGGCATCGAAAAG
TACAGAGAGATCGACATACTGTGCAACGAGGAGCTGCTCGGCAAGGATCA
CACGCTGAAGTTCGTCTACGTGACGCGCTGGCGCTTCCGGGATCCGCCGC
TTCGGCTGCAGTTTCGTCCGCGGGTCGAGCTCGCAAGCTTTCTAGACCAT

BO01427.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:57:53
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)73Ah-RA 669 CG4195-PA 1..666 17..682 3330 100 Plus
l(3)73Ah-RB 669 CG4195-PB 1..666 17..682 3330 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:57:54
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)73Ah-RA 1404 CG4195-RA 377..1043 16..682 3335 100 Plus
l(3)73Ah-RB 1322 CG4195-RB 295..961 16..682 3335 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:57:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16589245..16589530 274..559 1430 100 Plus
3L 28110227 3L 16589016..16589172 119..275 770 99.4 Plus
3L 28110227 3L 16589647..16589771 558..682 625 100 Plus
3L 28110227 3L 16588851..16588957 16..122 535 100 Plus
Blast to na_te.dros performed 2014-11-27 06:57:52
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 8763..8803 414..374 115 75.6 Minus

BO01427.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:14 Download gff for BO01427.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RA 1..669 17..686 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:03 Download gff for BO01427.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RA 935..1604 16..686 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:00:31 Download gff for BO01427.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RB 296..961 17..684 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:15 Download gff for BO01427.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RA 935..1604 16..686 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:59:14 Download gff for BO01427.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)73Ah-RB 296..961 17..684 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:59:14 Download gff for BO01427.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16589649..16589771 560..684 98   Plus
3L 16589247..16589530 276..559 100 -> Plus
3L 16589020..16589172 123..275 100 -> Plus
3L 16588852..16588957 17..122 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:00:31 Download gff for BO01427.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16582749..16582871 560..684 98   Plus
arm_3L 16582347..16582630 276..559 100 -> Plus
arm_3L 16582120..16582272 123..275 100 -> Plus
arm_3L 16581952..16582057 17..122 100 -> Plus

BO01427.pep Sequence

Translation from 16 to 700

> BO01427.pep
MERRVKLKTINPHITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKT
CPTCDNIIHQSHPLQYISFDRTMQDIVYKLVPKLQEDESRRERDFYKSRN
MPCPKDITQNHEDDNEKVMDAHAESDFHRLDEQVNVCLECISNNFKNLQR
RFIRCSSQATITHLKKLVAKKILNGIEKYREIDILCNEELLGKDHTLKFV
YVTRWRFRDPPLRLQFRPRVELASFLDH

BO01427.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:30:50
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)73Ah-PA 222 CG4195-PA 1..222 1..222 1202 100 Plus
l(3)73Ah-PB 222 CG4195-PB 1..222 1..222 1202 100 Plus
Psc-PC 1601 CG3886-PC 250..465 3..217 333 35 Plus
Psc-PB 1601 CG3886-PB 250..465 3..217 333 35 Plus
Psc-PA 1601 CG3886-PA 250..465 3..217 333 35 Plus