Clone BO01430 Report

Search the DGRC for BO01430

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptTrf-RA
Protein status:BO01430.pep: full length peptide match
Sequenced Size:706

Clone Sequence Records

BO01430.3prime Sequence

704 bp (703 high quality bases) assembled on 2005-11-30

> BO01430.3prime
ATGGTCTAGAAAGCTTGCCGTCTTGCGAAAACTTAGTAAAATAGGTGATA
TCGCCTCCAGGCAGTCCATAATGTCCTTGCGCGACTTGGCGCCCGTAAAT
ACAACCTTTCCGTTGACGAAGATCAGGAGAACGATGCGCGGCTTGACCAT
GCGATAGATTAGGCCTGGAAACATCTCCGGTTCGTAGGAACTAAACTGCC
CGTGCACGTGGTTGAGGTTCTCCAGGCGGATGGGGAAGCGCAGATCAACG
GTGGCCACAATATTCTGCAGCTTGTATTCCATGAACTTTACGGGGAATCC
CAGCTTCTGCAGGATGCGTGCGAACTTTCGCGATCCAATGTCCGCCTCAA
TCTCGTTTCGTGCACCCGTGCAGATGACCTTGCCCGTTCGAAAGATTAGC
GCTGTGCACCTGGGCGAGTGCATTCGCATGATGACGCCACGAAAGCGCTT
GGGCGAGTACTCCGAGTTCCTCGTACGCGAGTTGATTGCCTTGAGGTCCA
GTTCACAGTTCACCGAGAAGGTGGCCACGATATTCTGCAATCGTATCTCA
TGTTGTGCATCCTTGGGCTCCACCAGGGCAACGGGCTGTTGCGGCTGCAG
GGCTGCGTGCGGATTGGCGGCAGCATTGCTGGTCGCAGCCACATTATCCC
TGTCCCTTTCAGCGTCCGCGACTTTAAAGTGAAACTGCATGTCGACTGAT
AACT

BO01430.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG7562-PA 675 Trf-RA 1..672 690..19 3360 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 18:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
Trf-RA 983 CG7562-RA 77..748 690..19 3360 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 18:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8073197..8073713 535..19 2585 100 Minus
2L 23513712 2L 8072971..8073126 690..535 780 100 Minus
Blast to na_te.dros performed on 2015-02-04 18:53:17 has no hits.

BO01430.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:03 Download gff for BO01430.3prime
Subject Subject Range Query Range Percent Splice Strand
Trf-PA 1..675 18..690 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:49 Download gff for BO01430.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7562-PA 1..675 18..690 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:12:05 Download gff for BO01430.3prime
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 71..753 11..699 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:27:14 Download gff for BO01430.3prime
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 71..753 11..699 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:27:14 Download gff for BO01430.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 8073197..8073718 11..535 99   Minus
2L 8072965..8073125 536..699 97 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:12:05 Download gff for BO01430.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8073197..8073718 11..535 99   Minus
arm_2L 8072965..8073125 536..699 97 -> Minus

BO01430.5prime Sequence

704 bp (703 high quality bases) assembled on 2005-11-30

> BO01430.5prime
GAAGTTATCAGTCGACATGCAGTTTCACTTTAAAGTCGCGGACGCTGAAA
GGGACAGGGATAATGTGGCTGCGACCAGCAATGCTGCCGCCAATCCGCAC
GCAGCCCTGCAGCCGCAACAGCCCGTTGCCCTGGTGGAGCCCAAGGATGC
ACAACATGAGATACGATTGCAGAATATCGTGGCCACCTTCTCGGTGAACT
GTGAACTGGACCTCAAGGCAATCAACTCGCGTACGAGGAACTCGGAGTAC
TCGCCCAAGCGCTTTCGTGGCGTCATCATGCGAATGCACTCGCCCAGGTG
CACAGCGCTAATCTTTCGAACGGGCAAGGTCATCTGCACGGGTGCACGAA
ACGAGATTGAGGCGGACATTGGATCGCGAAAGTTCGCACGCATCCTGCAG
AAGCTGGGATTCCCCGTAAAGTTCATGGAATACAAGCTGCAGAATATTGT
GGCCACCGTTGATCTGCGCTTCCCCATCCGCCTGGAGAACCTCAACCACG
TGCACGGGCAGTTTAGTTCCTACGAACCGGAGATGTTTCCAGGCCTAATC
TATCGCATGGTCAAGCCGCGCATCGTTCTCCTGATCTTCGTCAACGGAAA
GGTTGTATTTACGGGCGCCAAGTCGCGCAAGGACATTATGGACTGCCTGG
AGGCGATATCACCTATTTTACTAAGTTTTCGCAAGACGGCAAGCTTTCTA
GACC

BO01430.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG7562-PA 675 Trf-RA 1..672 17..688 3360 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
Trf-RA 983 CG7562-RA 77..748 17..688 3360 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8073197..8073713 172..688 2585 100 Plus
2L 23513712 2L 8072971..8073126 17..172 780 100 Plus
Blast to na_te.dros performed on 2015-02-11 04:21:40 has no hits.

BO01430.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:04 Download gff for BO01430.5prime
Subject Subject Range Query Range Percent Splice Strand
Trf-PA 1..675 17..689 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:27:50 Download gff for BO01430.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7562-PA 1..675 17..689 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 05:01:24 Download gff for BO01430.5prime
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 71..753 8..696 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:02:47 Download gff for BO01430.5prime
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 71..753 8..696 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:02:47 Download gff for BO01430.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 8073197..8073718 172..696 99   Plus
2L 8072965..8073125 8..171 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 05:01:24 Download gff for BO01430.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8073197..8073718 172..696 99   Plus
arm_2L 8072965..8073125 8..171 97 -> Plus

BO01430.complete Sequence

706 bp (706 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629494

> BO01430.complete
GAAGTTATCAGTCGACATGCAGTTTCACTTTAAAGTCGCGGACGCTGAAA
GGGACAGGGATAATGTGGCTGCGACCAGCAATGCTGCCGCCAATCCGCAC
GCAGCCCTGCAGCCGCAACAGCCCGTTGCCCTGGTGGAGCCCAAGGATGC
ACAACATGAGATACGATTGCAGAATATCGTGGCCACCTTCTCGGTGAACT
GTGAACTGGACCTCAAGGCAATCAACTCGCGTACGAGGAACTCGGAGTAC
TCGCCCAAGCGCTTTCGTGGCGTCATCATGCGAATGCACTCGCCCAGGTG
CACAGCGCTAATCTTTCGAACGGGCAAGGTCATCTGCACGGGTGCACGAA
ACGAGATTGAGGCGGACATTGGATCGCGAAAGTTCGCACGCATCCTGCAG
AAGCTGGGATTCCCCGTAAAGTTCATGGAATACAAGCTGCAGAATATTGT
GGCCACCGTTGATCTGCGCTTCCCCATCCGCCTGGAGAACCTCAACCACG
TGCACGGGCAGTTTAGTTCCTACGAACCGGAGATGTTTCCAGGCCTAATC
TATCGCATGGTCAAGCCGCGCATCGTTCTCCTGATCTTCGTCAACGGAAA
GGTTGTATTTACGGGCGCCAAGTCGCGCAAGGACATTATGGACTGCCTGG
AGGCGATATCACCTATTTTACTAAGTTTTCGCAAGACGGCAAGCTTTCTA
GACCAT

BO01430.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
Trf-RA 675 CG7562-PA 1..672 17..688 3360 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
Trf-RA 983 CG7562-RA 77..748 17..688 3360 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8073197..8073713 172..688 2585 100 Plus
2L 23513712 2L 8072971..8073126 17..172 780 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:38:38 has no hits.

BO01430.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:17 Download gff for BO01430.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 1..675 17..689 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:04 Download gff for BO01430.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 69..751 8..696 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:43:30 Download gff for BO01430.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 77..748 17..690 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:17 Download gff for BO01430.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 69..751 8..696 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:49:44 Download gff for BO01430.complete
Subject Subject Range Query Range Percent Splice Strand
Trf-RA 77..748 17..690 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:49:44 Download gff for BO01430.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8073197..8073713 172..690 99   Plus
2L 8072971..8073125 17..171 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:43:30 Download gff for BO01430.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8073197..8073713 172..690 99   Plus
arm_2L 8072971..8073125 17..171 100 -> Plus

BO01430.pep Sequence

Translation from 16 to 706

> BO01430.pep
MQFHFKVADAERDRDNVAATSNAAANPHAALQPQQPVALVEPKDAQHEIR
LQNIVATFSVNCELDLKAINSRTRNSEYSPKRFRGVIMRMHSPRCTALIF
RTGKVICTGARNEIEADIGSRKFARILQKLGFPVKFMEYKLQNIVATVDL
RFPIRLENLNHVHGQFSSYEPEMFPGLIYRMVKPRIVLLIFVNGKVVFTG
AKSRKDIMDCLEAISPILLSFRKTASFLDH

BO01430.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:16:47
Subject Length Description Subject Range Query Range Score Percent Strand
Trf-PA 224 CG7562-PA 1..224 1..224 1146 100 Plus
Tbp-PA 353 CG9874-PA 148..351 22..223 586 55.9 Plus
Trf2-PJ 632 CG18009-PJ 157..379 1..226 333 33.8 Plus
Trf2-PH 632 CG18009-PH 157..379 1..226 333 33.8 Plus
Trf2-PI 1714 CG18009-PI 1239..1461 1..226 333 33.8 Plus