Clone BO01434 Report

Search the DGRC for BO01434

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptMED6-RA
Protein status:BO01434.pep: full length peptide match
Sequenced Size:781

Clone Sequence Records

BO01434.3prime Sequence

779 bp (778 high quality bases) assembled on 2005-11-30

> BO01434.3prime
ATGGTCTAGAAAGCTTGCCTTGCTCTTCTTTTCGGGCGGTGGCTTCATGT
CCACACCCTCGGTTTTGATATCTAGCGGTCCTGTGGCATTGTTCATTTCG
GAGGCATTTCTCGCTGTGTTCAGATCATCGCCCGCTGGTGGCGGCTGCTG
GAGATTCTGCAGCATGGGCGGTATTGGTGGGGGAAATTTACGCAAAAGCT
CTGCCAGCAGCATGTCCACACGCTGCTTCTGGAACAGTGTGCCGCTGTTC
TCATCCTTCGCTGAGTTGGCGTCCTTCTTATCTGACTTGGATCTATCTGA
AAAAACTTTATTGGAAGAGAAGTCCCACGTGTAGCCCTTGTTGGGATGGT
AGCGGGCATAGCTACTAGCCTCCTCGAAGGCGGATTGCAGGTTCACCACG
GTGTTGAGAATGCGGGAATTGATGACGTTGGCAAGATCTGGCGCCTTGTA
GACGGTGCCACCAATGATGTAGTAATCGGCAATCGGCGTGGCTTCCGAGG
GATTATGACGGTGCTGCTTGCGGATTACATACAGGATGGGCTCCGCCACG
TGCAGCAGTATGTATTCCAGACCGATCATGTTGTGCAGATGCTCGGGACC
AAGGCGCTGCATCCGAACAGTCTCGTTGTTGCACATGTGATCATAGAAGG
GATTCGACTTGCGGCAGAAGTAGTCCATGACGGTCTGCGGGCTGAGGGTG
GCCATCATCTGGGTGTCGTGCCAGGAAAGGCGCANGTGGTCATTGGTCAT
CTGTCGGCTGGCCATGTCGACTGATAACT

BO01434.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG9473-PB 750 MED6-RB 1..747 765..19 3716 99.8 Minus
CG9473-PA 750 MED6-RA 1..747 765..19 3716 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 18:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
MED6-RE 1617 CG9473-RE 458..1204 765..19 3724 99.9 Minus
MED6-RD 1814 CG9473-RD 655..1401 765..19 3724 99.9 Minus
MED6-RC 1770 CG9473-RC 611..1357 765..19 3724 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 18:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9766444..9766727 19..302 1420 100 Plus
3R 32079331 3R 9767177..9767358 584..765 899 99.5 Plus
3R 32079331 3R 9766948..9767122 409..583 875 100 Plus
3R 32079331 3R 9766788..9766893 303..408 530 100 Plus
Blast to na_te.dros performed on 2015-02-04 18:53:30 has no hits.

BO01434.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:10 Download gff for BO01434.3prime
Subject Subject Range Query Range Percent Splice Strand
MED6-PA 1..750 16..765 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:00 Download gff for BO01434.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9473-PA 1..750 16..765 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:12:06 Download gff for BO01434.3prime
Subject Subject Range Query Range Percent Splice Strand
MED6-RC 603..1357 19..773 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:27:15 Download gff for BO01434.3prime
Subject Subject Range Query Range Percent Splice Strand
MED6-RC 603..1357 19..773 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:27:15 Download gff for BO01434.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 9767177..9767366 584..773 97   Plus
3R 9766948..9767122 409..583 100 <- Plus
3R 9766788..9766893 303..408 100 <- Plus
3R 9766444..9766727 19..302 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:12:06 Download gff for BO01434.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5592899..5593088 584..773 97   Plus
arm_3R 5592670..5592844 409..583 100 <- Plus
arm_3R 5592510..5592615 303..408 100 <- Plus
arm_3R 5592166..5592449 19..302 100 <- Plus

BO01434.5prime Sequence

779 bp (680 high quality bases) assembled on 2005-11-30

> BO01434.5prime
GAAGTTATCAGTCGACATGGCCAGCCGACAGATGACCAATGACCACCTGC
GCCTTTCCTGGCACGACACCCAGATGATGGCCACCCTCAGCCCGCAGACC
GTCATGGACTACTTCTGCCGCAAGTCGAATCCCTTCTATGATCACATGTG
CAACAACGAGACTGTTCGGATGCAGCGCCTTGGTCCCGAGCATCTGCACA
ACATGATCGGTCTGGAATACATACTGCTGCACGTGGCGGAGCCCATCCTG
TATGTAATCCGCAAGCAGCACCGTCATAATCCCTCGGAAGCCACGCCGAT
TGCCGATTACTACATCATTGGTGGCACCGTCTACAAGGCGCCAGATCTTG
CCAACGTCATCAATTCCCGCATTCTCAACACCGTGGTGAACCTGCAATCC
GCCTTCGAGGAGGCTAGTAGCTATGCCCGCTACCATCCCAACAAGGGCTA
CACGTGGGACTTCTCTTCCAATAAAGTTTTTTCAGATAGATCCAAGTCAG
ATAAGAAGGACGCCAACTCAGCGAAGGATGAGAACAGCGGCACACTGTTC
CAGAAGCAGCGTGTGGACATGCTGCTGGCAGAGCTTTTGCGTAAATTTCC
CCCACCAATACCGCCCATGCTGCAGAATCTCCAGCAGCCGCCACCAGCGG
GCGATGATCTGAACACAGCGAGAAATGCCTCCGAAATGAACAATGCCACA
GGACCGCTAGATATCAAAACCGAGGGTGTGGACATGAAGCCACCGCCCGA
AAAGAAGAGCAAGGCAAGCTTTCTAGACC

BO01434.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG9473-PB 750 MED6-RB 1..747 17..763 3735 100 Plus
CG9473-PA 750 MED6-RA 1..747 17..763 3735 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
MED6-RE 1617 CG9473-RE 458..1204 17..763 3735 100 Plus
MED6-RD 1814 CG9473-RD 655..1401 17..763 3735 100 Plus
MED6-RC 1770 CG9473-RC 611..1357 17..763 3735 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:21:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9766444..9766727 763..480 1420 100 Minus
3R 32079331 3R 9767177..9767358 198..17 910 100 Minus
3R 32079331 3R 9766948..9767122 373..199 875 100 Minus
3R 32079331 3R 9766788..9766893 479..374 530 100 Minus
Blast to na_te.dros performed on 2015-02-12 10:21:43 has no hits.

BO01434.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:11 Download gff for BO01434.5prime
Subject Subject Range Query Range Percent Splice Strand
MED6-PA 1..750 17..766 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:02 Download gff for BO01434.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9473-PA 1..750 17..766 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:48:42 Download gff for BO01434.5prime
Subject Subject Range Query Range Percent Splice Strand
MED6-RC 603..1357 9..763 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 12:54:31 Download gff for BO01434.5prime
Subject Subject Range Query Range Percent Splice Strand
MED6-RC 603..1357 9..763 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 12:54:31 Download gff for BO01434.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 9767177..9767366 9..198 98   Minus
3R 9766948..9767122 199..373 100 <- Minus
3R 9766788..9766893 374..479 100 <- Minus
3R 9766444..9766727 480..763 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:48:42 Download gff for BO01434.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5592899..5593088 9..198 98   Minus
arm_3R 5592670..5592844 199..373 100 <- Minus
arm_3R 5592510..5592615 374..479 100 <- Minus
arm_3R 5592166..5592449 480..763 100 <- Minus

BO01434.complete Sequence

781 bp (781 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629496

> BO01434.complete
GAAGTTATCAGTCGACATGGCCAGCCGACAGATGACCAATGACCACCTGC
GCCTTTCCTGGCACGACACCCAGATGATGGCCACCCTCAGCCCGCAGACC
GTCATGGACTACTTCTGCCGCAAGTCGAATCCCTTCTATGATCACATGTG
CAACAACGAGACTGTTCGGATGCAGCGCCTTGGTCCCGAGCATCTGCACA
ACATGATCGGTCTGGAATACATACTGCTGCACGTGGCGGAGCCCATCCTG
TATGTAATCCGCAAGCAGCACCGTCATAATCCCTCGGAAGCCACGCCGAT
TGCCGATTACTACATCATTGGTGGCACCGTCTACAAGGCGCCAGATCTTG
CCAACGTCATCAATTCCCGCATTCTCAACACCGTGGTGAACCTGCAATCC
GCCTTCGAGGAGGCTAGTAGCTATGCCCGCTACCATCCCAACAAGGGCTA
CACGTGGGACTTCTCTTCCAATAAAGTTTTTTCAGATAGATCCAAGTCAG
ATAAGAAGGACGCCAACTCAGCGAAGGATGAGAACAGCGGCACACTGTTC
CAGAAGCAGCGTGTGGACATGCTGCTGGCAGAGCTTTTGCGTAAATTTCC
CCCACCAATACCGCCCATGCTGCAGAATCTCCAGCAGCCGCCACCAGCGG
GCGATGATCTGAACACAGCGAGAAATGCCTCCGAAATGAACAATGCCACA
GGACCGCTAGATATCAAAACCGAGGGTGTGGACATGAAGCCACCGCCCGA
AAAGAAGAGCAAGGCAAGCTTTCTAGACCAT

BO01434.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
MED6-RE 750 CG9473-PE 1..747 17..763 3735 100 Plus
MED6-RD 750 CG9473-PD 1..747 17..763 3735 100 Plus
MED6-RC 750 CG9473-PC 1..747 17..763 3735 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
MED6-RE 1617 CG9473-RE 458..1204 17..763 3735 100 Plus
MED6-RD 1814 CG9473-RD 655..1401 17..763 3735 100 Plus
MED6-RC 1770 CG9473-RC 611..1357 17..763 3735 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:26:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9766444..9766727 763..480 1420 100 Minus
3R 32079331 3R 9767177..9767358 198..17 910 100 Minus
3R 32079331 3R 9766948..9767122 373..199 875 100 Minus
3R 32079331 3R 9766788..9766893 479..374 530 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:26:22 has no hits.

BO01434.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:20 Download gff for BO01434.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RA 1..750 17..766 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:07 Download gff for BO01434.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RA 628..1382 9..763 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:58:04 Download gff for BO01434.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RC 611..1357 17..765 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:20 Download gff for BO01434.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RA 628..1382 9..763 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:01:05 Download gff for BO01434.complete
Subject Subject Range Query Range Percent Splice Strand
MED6-RC 611..1357 17..765 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:01:05 Download gff for BO01434.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9767177..9767358 17..198 100   Minus
3R 9766948..9767122 199..373 100 <- Minus
3R 9766788..9766893 374..479 100 <- Minus
3R 9766441..9766727 480..765 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:58:04 Download gff for BO01434.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5592899..5593080 17..198 100   Minus
arm_3R 5592670..5592844 199..373 100 <- Minus
arm_3R 5592510..5592615 374..479 100 <- Minus
arm_3R 5592163..5592449 480..765 99 <- Minus

BO01434.pep Sequence

Translation from 16 to 781

> BO01434.pep
MASRQMTNDHLRLSWHDTQMMATLSPQTVMDYFCRKSNPFYDHMCNNETV
RMQRLGPEHLHNMIGLEYILLHVAEPILYVIRKQHRHNPSEATPIADYYI
IGGTVYKAPDLANVINSRILNTVVNLQSAFEEASSYARYHPNKGYTWDFS
SNKVFSDRSKSDKKDANSAKDENSGTLFQKQRVDMLLAELLRKFPPPIPP
MLQNLQQPPPAGDDLNTARNASEMNNATGPLDIKTEGVDMKPPPEKKSKA
SFLDH

BO01434.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
MED6-PE 249 CG9473-PE 1..249 1..249 1325 100 Plus
MED6-PD 249 CG9473-PD 1..249 1..249 1325 100 Plus
MED6-PC 249 CG9473-PC 1..249 1..249 1325 100 Plus
MED6-PA 249 CG9473-PA 1..249 1..249 1325 100 Plus
MED6-PB 249 CG9473-PB 1..249 1..249 1325 100 Plus