Clone BO01438 Report

Search the DGRC for BO01438

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptAdf1-RA
Protein status:BO01438.pep: full length peptide match
Sequenced Size:793

Clone Sequence Records

BO01438.3prime Sequence

750 bp (749 high quality bases) assembled on 2005-11-30

> BO01438.3prime
ATGGTCTAGAAAGCTTGCGTACTTGTTGTGCTGTGCCAGAAGCTGCATGT
CCGTCAGATACTTGATGATGTGCACCTTCGCCTCTGCCTTTTGTCGCACG
CCCAGCGTGTTGAGCATGTCCGTGACTACCATGCCGAACGACTGGTCCTC
GGCGCTGACCGCCTGCGAGACGTTGTTTTGGAAAATCTTGATGGTGTTGA
GCATGTTGTCGCTGTGCTCCTCCTCACTGCGCTCTCGCTTGAGCGGCGGC
TCGTAGAAGTATGGCTTTTGGTCCTTGCCCACGGCAGTGGCCAGCTGTGC
ATCGCTGGTGACAGTAATTTCATGCGGATGGGTCAGTGCCTGGGCCGAGG
TTGTGGCGCTGCCGTTGAAGGGCTGTGCAAATATATCCACGACGGTCTGT
TGCTGCGCCTGCTGCTGCTGCGACGGATCGGCCACCTGGTTGGCGCTTTG
ACTCCCATTGGCGCACTTGCCGAGCAGCGACTCTCGATACTGGCGGATGG
AGTCAACCAGGAATTGCATCTGCTTGAAGTAACGCCAGCGCGATTCCTGA
CATAGTTTCATCTCGCGGGCGAACTTGTCGCGCAGACTCTTCCAGCGCTT
CGTACATTTTTGTTCAGGCACACCGAGCGTTTCGGCGATTTGTTTCCAGG
TCTGGGCCTTGCGCACAAAGTGCTTGTAATTGTAGTGCGACCTGTCGTAT
ATCACTGGGTTCAGCTTGACAGCCTCGATGAGATTGAGATCAAACTGCTG

BO01438.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG15845-PA 762 Adf1-RA 28..759 750..19 3660 100 Minus
CG15845-PB 762 Adf1-RB 28..759 750..19 3660 100 Minus
CG15845-PC 789 Adf1-RC 55..786 750..19 3660 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-RE 1668 CG15845-RE 226..957 750..19 3660 100 Minus
Adf1-RC 1675 CG15845-RC 233..964 750..19 3660 100 Minus
Adf1-RB 1795 CG15845-RB 353..1084 750..19 3660 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6667072..6667374 321..19 1515 100 Minus
2R 25286936 2R 6666719..6667013 615..321 1475 100 Minus
2R 25286936 2R 6662622..6662757 750..615 680 100 Minus
Blast to na_te.dros performed on 2015-02-13 16:15:10 has no hits.

BO01438.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:16 Download gff for BO01438.3prime
Subject Subject Range Query Range Percent Splice Strand
Adf1-PB 28..762 15..750 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:10 Download gff for BO01438.3prime
Subject Subject Range Query Range Percent Splice Strand
CG15845-PC 55..789 15..750 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:57:21 Download gff for BO01438.3prime
Subject Subject Range Query Range Percent Splice Strand
Adf1-RB 353..1092 9..750 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:23:56 Download gff for BO01438.3prime
Subject Subject Range Query Range Percent Splice Strand
Adf1-RB 353..1092 9..750 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:23:56 Download gff for BO01438.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 6667073..6667382 9..320 98   Minus
2R 6666720..6667013 321..614 100 -> Minus
2R 6662622..6662757 615..750 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:57:21 Download gff for BO01438.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2554578..2554887 9..320 98   Minus
arm_2R 2554225..2554518 321..614 100 -> Minus
arm_2R 2550127..2550262 615..750 100 -> Minus

BO01438.5prime Sequence

791 bp (715 high quality bases) assembled on 2005-11-30

> BO01438.5prime
GAAGTTATCAGTCGACATGGACAAGCTGGATGCCAATCTTGAGCAGCAGT
TTGATCTCAATCTCATCGAGGCTGTCAAGCTGAACCCAGTGATATACGAC
AGGTCGCACTACAATTACAAGCACTTTGTGCGCAAGGCCCAGACCTGGAA
ACAAATCGCCGAAACGCTCGGTGTGCCTGAACAAAAATGTACGAAGCGCT
GGAAGAGTCTGCGCGACAAGTTCGCCCGCGAGATGAAACTATGTCAGGAA
TCGCGCTGGCGTTACTTCAAGCAGATGCAATTCCTGGTTGACTCCATCCG
CCAGTATCGAGAGTCGCTGCTCGGCAAGTGCGCCAATGGGAGTCAAAGCG
CCAACCAGGTGGCCGATCCGTCGCAGCAGCAGCAGGCGCAGCAACAGACC
GTCGTGGATATATTTGCACAGCCCTTCAACGGCAGCGCCACAACCTCGGC
CCAGGCACTGACCCATCCGCATGAAATTACTGTCACCAGCGATGCACAGC
TGGCCACTGCCGTGGGCAAGGACCAAAAGCCATACTTCTACGAGCCGCCG
CTCAAGCGAGAGCGCAGTGAGGAGGAGCACAGCGACAACATGCTCAACAC
CATCAAGATTTTCCAAAACAACGTCTCGCAGGCGGTCAGCGCCGAGGACC
AGTCGTTCGGCATGGTAGTCACGGACATGCTCAACACGCTGGGCGTGCGA
CAAAAGGCAGAGGCGAAGGTGCACATCATCAAGTATCTGACGGACATGCA
GCTTCTGGCACAGCACAACAAGTACGCAAGCTTTCTAGACC

BO01438.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG15845-PA 762 Adf1-RA 1..759 17..775 3795 100 Plus
CG15845-PB 762 Adf1-RB 1..759 17..775 3795 100 Plus
CG15845-PC 789 Adf1-RC 28..786 17..775 3795 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-RE 1668 CG15845-RE 199..957 17..775 3795 100 Plus
Adf1-RC 1675 CG15845-RC 206..964 17..775 3795 100 Plus
Adf1-RB 1795 CG15845-RB 326..1084 17..775 3795 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6667072..6667374 473..775 1515 100 Plus
2R 25286936 2R 6666719..6667013 179..473 1475 100 Plus
2R 25286936 2R 6662595..6662757 17..179 815 100 Plus
Blast to na_te.dros performed on 2015-02-13 16:15:17 has no hits.

BO01438.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:17 Download gff for BO01438.5prime
Subject Subject Range Query Range Percent Splice Strand
Adf1-PB 1..762 17..779 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:11 Download gff for BO01438.5prime
Subject Subject Range Query Range Percent Splice Strand
CG15845-PC 21..789 9..779 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:57:23 Download gff for BO01438.5prime
Subject Subject Range Query Range Percent Splice Strand
Adf1-RB 319..1092 9..785 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:24:23 Download gff for BO01438.5prime
Subject Subject Range Query Range Percent Splice Strand
Adf1-RB 319..1092 9..785 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:24:23 Download gff for BO01438.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 6667073..6667382 474..785 98   Plus
2R 6666720..6667013 180..473 100 -> Plus
2R 6662588..6662757 9..179 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:57:23 Download gff for BO01438.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2554578..2554887 474..785 98   Plus
arm_2R 2554225..2554518 180..473 100 -> Plus
arm_2R 2550093..2550262 9..179 98 -> Plus

BO01438.complete Sequence

793 bp (793 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629497

> BO01438.complete
GAAGTTATCAGTCGACATGGACAAGCTGGATGCCAATCTTGAGCAGCAGT
TTGATCTCAATCTCATCGAGGCTGTCAAGCTGAACCCAGTGATATACGAC
AGGTCGCACTACAATTACAAGCACTTTGTGCGCAAGGCCCAGACCTGGAA
ACAAATCGCCGAAACGCTCGGTGTGCCTGAACAAAAATGTACGAAGCGCT
GGAAGAGTCTGCGCGACAAGTTCGCCCGCGAGATGAAACTATGTCAGGAA
TCGCGCTGGCGTTACTTCAAGCAGATGCAATTCCTGGTTGACTCCATCCG
CCAGTATCGAGAGTCGCTGCTCGGCAAGTGCGCCAATGGGAGTCAAAGCG
CCAACCAGGTGGCCGATCCGTCGCAGCAGCAGCAGGCGCAGCAACAGACC
GTCGTGGATATATTTGCACAGCCCTTCAACGGCAGCGCCACAACCTCGGC
CCAGGCACTGACCCATCCGCATGAAATTACTGTCACCAGCGATGCACAGC
TGGCCACTGCCGTGGGCAAGGACCAAAAGCCATACTTCTACGAGCCGCCG
CTCAAGCGAGAGCGCAGTGAGGAGGAGCACAGCGACAACATGCTCAACAC
CATCAAGATTTTCCAAAACAACGTCTCGCAGGCGGTCAGCGCCGAGGACC
AGTCGTTCGGCATGGTAGTCACGGACATGCTCAACACGCTGGGCGTGCGA
CAAAAGGCAGAGGCGAAGGTGCACATCATCAAGTATCTGACGGACATGCA
GCTTCTGGCACAGCACAACAAGTACGCAAGCTTTCTAGACCAT

BO01438.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-RE 825 CG15845-PE 1..759 17..775 3795 100 Plus
Adf1-RC 789 CG15845-PC 28..786 17..775 3795 100 Plus
Adf1-RB 762 CG15845-PB 1..759 17..775 3795 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:59:10
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-RE 1668 CG15845-RE 199..957 17..775 3795 100 Plus
Adf1-RC 1675 CG15845-RC 206..964 17..775 3795 100 Plus
Adf1-RB 1795 CG15845-RB 326..1084 17..775 3795 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6667072..6667374 473..775 1515 100 Plus
2R 25286936 2R 6666719..6667013 179..473 1475 100 Plus
2R 25286936 2R 6662595..6662757 17..179 815 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:59:08 has no hits.

BO01438.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:21 Download gff for BO01438.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 21..789 9..779 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:09 Download gff for BO01438.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 200..973 9..785 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:56:20 Download gff for BO01438.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RB 326..1084 17..777 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:21 Download gff for BO01438.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RC 200..973 9..785 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:31:44 Download gff for BO01438.complete
Subject Subject Range Query Range Percent Splice Strand
Adf1-RB 326..1084 17..777 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:31:44 Download gff for BO01438.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6667073..6667374 474..777 99   Plus
2R 6666720..6667013 180..473 100 -> Plus
2R 6662595..6662757 17..179 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:56:20 Download gff for BO01438.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2554578..2554879 474..777 99   Plus
arm_2R 2554225..2554518 180..473 100 -> Plus
arm_2R 2550100..2550262 17..179 100 -> Plus

BO01438.pep Sequence

Translation from 16 to 793

> BO01438.pep
MDKLDANLEQQFDLNLIEAVKLNPVIYDRSHYNYKHFVRKAQTWKQIAET
LGVPEQKCTKRWKSLRDKFAREMKLCQESRWRYFKQMQFLVDSIRQYRES
LLGKCANGSQSANQVADPSQQQQAQQQTVVDIFAQPFNGSATTSAQALTH
PHEITVTSDAQLATAVGKDQKPYFYEPPLKRERSEEEHSDNMLNTIKIFQ
NNVSQAVSAEDQSFGMVVTDMLNTLGVRQKAEAKVHIIKYLTDMQLLAQH
NKYASFLDH

BO01438.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
Adf1-PB 253 CG15845-PB 1..253 1..253 1311 100 Plus
Adf1-PA 253 CG15845-PA 1..253 1..253 1311 100 Plus
Adf1-PC 262 CG15845-PC 10..262 1..253 1311 100 Plus
Adf1-PE 274 CG15845-PE 1..253 1..253 1311 100 Plus
CG10949-PB 459 CG10949-PB 131..391 2..236 170 25.6 Plus