Clone BO01444 Report

Search the DGRC for BO01444

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG14667-RA
Protein status:BO01444.pep: full length peptide match
Sequenced Size:808

Clone Sequence Records

BO01444.3prime Sequence

806 bp (805 high quality bases) assembled on 2005-11-30

> BO01444.3prime
ATGGTCTAGAAAGCTTGCCTTGTCGTGCCGCAACTTAGCGCCCAGAGACG
CGAAAGCCTCGTGGCAGATGGTGCACTGGAACCTGCGGTTAATTAAATGA
ACCTGGGTGCGATGCTGCTTGAGAAGCGCCTTCTTGTTAAAAGTCTGTGG
GCACTCAGGGCAGGGGAAGAACTGGTTCATATCCCGCCGGTTCTGGTGCC
CATTTAAATGCTCGGTGTACAGGAACGCATCGTGGAACAGGGTTCCACAC
TCGTCGCAGATAAAGAAGTTACTGCGCCTCTTGGCGGCCCGCTCCATTTC
CTGCTCCTGTAGATCCTCCTGCTGCGCCGCTTCTGCTGCCGCCTCTGCTG
CCGCTATCACAGCGGCAGAGGGGTCGTCATCCAGCTCGATTTCCTCTAGG
TCTTGGTGTTCCTCTTTCGTGCCTTGATAACAAACGTACTGGTCGTCATC
GTAGTGCGTCTCCAATTGATCCGCATCGATCAGTTGCTCGTCCAGCGGCT
CGGAACTAAGCTCAACGTGAACAGTGCTTTGATCACTGGTCTTCTTTATG
ATATCCAGCAGGTACTTTTGCGAGAAGATGCACCGCTCGCGGAACTTGGT
GGCCAGGTCCAGCTCGGAGAAGCAGCGCTCGCAAACAATCTCCGGCAGCC
CCTGGTTTCTTGTCAGCTCCACTCCCGTGATTAGCTTCAGTTGACCCAAA
TATTTTCCCCGCATGTGAATGAATATGTTGCGATCTCGCTGGTGGCCCAT
AATTTTGTTGGCGCAAATACGGCAAACGTCGGCGAGGTTCATGTCGACTG
ATAACT

BO01444.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14667-PA 777 CG14667-RA 1..774 792..19 3870 100 Minus
CG14667-PB 1014 CG14667-RB 1..773 792..20 3865 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14667-RB 1260 CG14667-RB 70..842 792..20 3865 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5375276..5375925 668..19 3250 100 Minus
3R 32079331 3R 5375091..5375216 792..667 630 100 Minus
Blast to na_te.dros performed on 2015-02-12 00:34:57 has no hits.

BO01444.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:25 Download gff for BO01444.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14667-PA 1..777 15..792 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:24 Download gff for BO01444.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14667-PA 1..777 15..792 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:31:58 Download gff for BO01444.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 22..799 14..792 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:05:10 Download gff for BO01444.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14667-RB 70..845 17..792 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:05:10 Download gff for BO01444.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 5375278..5375929 14..666 99   Minus
3R 5375091..5375216 667..792 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:31:58 Download gff for BO01444.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1201000..1201651 14..666 99   Minus
arm_3R 1200813..1200938 667..792 100 -> Minus

BO01444.5prime Sequence

806 bp (784 high quality bases) assembled on 2005-11-30

> BO01444.5prime
GAAGTTATCAGTCGACATGAACCTCGCCGACGTTTGCCGTATTTGCGCCA
ACAAAATTATGGGCCACCAGCGAGATCGCAACATATTCATTCACATGCGG
GGAAAATATTTGGGTCAACTGAAGCTAATCACGGGAGTGGAGCTGACAAG
AAACCAGGGGCTGCCGGAGATTGTTTGCGAGCGCTGCTTCTCCGAGCTGG
ACCTGGCCACCAAGTTCCGCGAGCGGTGCATCTTCTCGCAAAAGTACCTG
CTGGATATCATAAAGAAGACCAGTGATCAAAGCACTGTTCACGTTGAGCT
TAGTTCCGAGCCGCTGGACGAGCAACTGATCGATGCGGATCAATTGGAGA
CGCACTACGATGACGACCAGTACGTTTGTTATCAAGGCACGAAAGAGGAA
CACCAAGACCTAGAGGAAATCGAGCTGGATGACGACCCCTCTGCCGCTGT
GATAGCGGCAGCAGAGGCGGCAGCAGAAGCGGCGCAGCAGGAGGATCTAC
AGGAGCAGGAAATGGAGCGGGCCGCCAAGAGGCGCAGTAACTTCTTTATC
TGCGACGAGTGTGGAACCCTGTTCCACGATGCGTTCCTGTACACCGAGCA
TTTAAATGGGCACCAGAACCGGCGGGATATGAACCAGTTCTTCCCCTGCC
CTGAGTGCCCACAGACTTTTAACAAGAAGGCGCTTCTCAAGCAGCATCGC
ACCCAGGTTCATTTAATTAACCGCAGGTTCCAGTGCACCATCTGCCACGA
GGCTTTCGCGTCTCTGGGCGCTAAGTTGCGGCACGACAAGGCAAGCTTTC
TAGACC

BO01444.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG14667-PA 777 CG14667-RA 1..774 17..790 3870 100 Plus
CG14667-PB 1014 CG14667-RB 1..773 17..789 3865 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG14667-RB 1260 CG14667-RB 70..842 17..789 3865 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5375276..5375925 141..790 3250 100 Plus
3R 32079331 3R 5375091..5375216 17..142 630 100 Plus
Blast to na_te.dros performed on 2015-02-12 05:50:04 has no hits.

BO01444.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:26 Download gff for BO01444.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14667-PA 1..777 17..794 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:25 Download gff for BO01444.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14667-PA 1..777 17..794 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:18:15 Download gff for BO01444.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 22..799 17..795 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:56:24 Download gff for BO01444.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14667-RB 70..845 17..792 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:56:24 Download gff for BO01444.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 5375278..5375929 143..795 99   Plus
3R 5375091..5375216 17..142 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:18:15 Download gff for BO01444.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1201000..1201651 143..795 99   Plus
arm_3R 1200813..1200938 17..142 100 -> Plus

BO01444.complete Sequence

808 bp (808 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629500

> BO01444.complete
GAAGTTATCAGTCGACATGAACCTCGCCGACGTTTGCCGTATTTGCGCCA
ACAAAATTATGGGCCACCAGCGAGATCGCAACATATTCATTCACATGCGG
GGAAAATATTTGGGTCAACTGAAGCTAATCACGGGAGTGGAGCTGACAAG
AAACCAGGGGCTGCCGGAGATTGTTTGCGAGCGCTGCTTCTCCGAGCTGG
ACCTGGCCACCAAGTTCCGCGAGCGGTGCATCTTCTCGCAAAAGTACCTG
CTGGATATCATAAAGAAGACCAGTGATCAAAGCACTGTTCACGTTGAGCT
TAGTTCCGAGCCGCTGGACGAGCAACTGATCGATGCGGATCAATTGGAGA
CGCACTACGATGACGACCAGTACGTTTGTTATCAAGGCACGAAAGAGGAA
CACCAAGACCTAGAGGAAATCGAGCTGGATGACGACCCCTCTGCCGCTGT
GATAGCGGCAGCAGAGGCGGCAGCAGAAGCGGCGCAGCAGGAGGATCTAC
AGGAGCAGGAAATGGAGCGGGCCGCCAAGAGGCGCAGTAACTTCTTTATC
TGCGACGAGTGTGGAACCCTGTTCCACGATGCGTTCCTGTACACCGAGCA
TTTAAATGGGCACCAGAACCGGCGGGATATGAACCAGTTCTTCCCCTGCC
CTGAGTGCCCACAGACTTTTAACAAGAAGGCGCTTCTCAAGCAGCATCGC
ACCCAGGTTCATTTAATTAACCGCAGGTTCCAGTGCACCATCTGCCACGA
GGCTTTCGCGTCTCTGGGCGCTAAGTTGCGGCACGACAAGGCAAGCTTTC
TAGACCAT

BO01444.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:13:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG14667-RB 1014 CG14667-PB 1..773 17..789 3865 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG14667-RB 1260 CG14667-RB 70..842 17..789 3865 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5375276..5375925 141..790 3250 100 Plus
3R 32079331 3R 5375091..5375216 17..142 630 100 Plus
Blast to na_te.dros performed on 2014-11-28 01:13:33 has no hits.

BO01444.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:44:51 Download gff for BO01444.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 1..777 17..794 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:15:24 Download gff for BO01444.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 22..799 17..795 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:42:57 Download gff for BO01444.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 22..795 17..792 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:44:51 Download gff for BO01444.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RA 22..799 17..795 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:48:04 Download gff for BO01444.complete
Subject Subject Range Query Range Percent Splice Strand
CG14667-RB 70..845 17..792 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:48:04 Download gff for BO01444.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5375278..5375925 143..792 99   Plus
3R 5375091..5375216 17..142 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:42:57 Download gff for BO01444.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1201000..1201647 143..792 99   Plus
arm_3R 1200813..1200938 17..142 100 -> Plus

BO01444.pep Sequence

Translation from 16 to 808

> BO01444.pep
MNLADVCRICANKIMGHQRDRNIFIHMRGKYLGQLKLITGVELTRNQGLP
EIVCERCFSELDLATKFRERCIFSQKYLLDIIKKTSDQSTVHVELSSEPL
DEQLIDADQLETHYDDDQYVCYQGTKEEHQDLEEIELDDDPSAAVIAAAE
AAAEAAQQEDLQEQEMERAAKRRSNFFICDECGTLFHDAFLYTEHLNGHQ
NRRDMNQFFPCPECPQTFNKKALLKQHRTQVHLINRRFQCTICHEAFASL
GAKLRHDKASFLDH

BO01444.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG14667-PB 337 CG14667-PB 1..259 1..259 1376 100 Plus
CG8159-PB 399 CG8159-PB 2..268 3..258 224 24.9 Plus
M1BP-PA 418 CG9797-PA 8..327 2..258 210 23.3 Plus
ranshi-PA 346 CG9793-PA 5..272 6..258 198 23.7 Plus
CG11762-PA 312 CG11762-PA 5..243 6..258 187 25.1 Plus