Clone BO01446 Report

Search the DGRC for BO01446

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:46
Vector:pDNR-Dual
Associated Gene/TranscriptPdp1-RB
Protein status:BO01446.pep: full length peptide match
Sequenced Size:844

Clone Sequence Records

BO01446.3prime Sequence

842 bp (796 high quality bases) assembled on 2005-11-30

> BO01446.3prime
ATGGTCTAGAAAGCTTGCCACATCTTGGAATTTCGATAGACGTGCACGCA
AGTCCATGTTCTCCTGTTTCAACTGCTCCACCTCCTGATGTAATGTTGCA
TTTTCCTTCTCCAAGTAGCGTGCCCGCATCGCAATCTGGTTCTCCTTCTG
GCGCCGGGCATCGCGGGATCGCTTGGCGGCAATGTTGTTCTTCCGGCGAC
GTGCCCAGTACTTGTCGTCCTTGAGCTCATCTGGAACGAATTGCTTGCGT
GACTTTTTGATCATCGGCTGCGGCTTGAGCTCCTCGTCGGAGAAGGCTCT
GGTTCGCGGATCAAAGTCACGGCCCGAGGAGGCGAACGAAAATGTTGACT
CGGCCGGCGATGGCGGATTTAGCGTGTCCGGACTGATGCAGTCGGATGGC
GAGGGCGACCGCTCTCGCTTTGTGGTTATGTGGCCAAGACCAAGAGACAG
ACCCGCTGCGTGACCCAGGGAATCGGACCGGTGGCCCAGGCCACTGGAGT
GGCCCAGATGCGTGCCGGGCAGGCCATCAGGTATGTTGTTCTCCGACAGG
AATTCGTCTAGGTCGGCATATTGTGTTACCTTGAGGTCGGCATCATAGGG
CAGGGTCTTGTCCCACAGATTTGGGCCGAGAAACGCTGTTTGCGCCTCAA
CATTCCAGATGTCGCCCTCCTCCTTGTATTTGTCATCTGGGCAGATGATC
TCTTTGCTATTCGATGTGGATTTGCCATTAATGCCGCTGATCAGTGGGTA
ATTACCATCACGGCCGCCAATTAAGTTTTTTTAACCAGTTTCGATCAGTG
TTGGGGACGATCGCTCCCTGTCGCTCATGTCGACTGATAACT

BO01446.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG17888-PB 813 Pdp1-RB 1..810 828..19 4025 99.8 Minus
CG17888-PA 813 Pdp1-RA 1..810 828..19 4025 99.8 Minus
CG17888-PG 855 Pdp1-RG 145..852 726..19 3540 100 Minus
CG17888-PE 855 Pdp1-RE 145..852 726..19 3540 100 Minus
CG17888-PF 753 Pdp1-RF 43..750 726..19 3540 100 Minus
CG17888-PD 1944 Pdp1-RD 1234..1941 726..19 3540 100 Minus
CG17888-PH 1062 Pdp1-RH 352..1059 726..19 3540 100 Minus
CG17888-PC 1713 Pdp1-RC 1003..1710 726..19 3540 100 Minus
CG17888-PG 855 Pdp1-RG 1..106 828..723 505 99 Minus
CG17888-PE 855 Pdp1-RE 1..106 828..723 505 99 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 18:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
Pdp1-RK 6855 CG17888-RK 1175..1984 828..19 4035 99.9 Minus
Pdp1-RP 6398 CG17888-RP 1175..1984 828..19 4035 99.9 Minus
Pdp1-RB 5065 CG17888-RB 2264..3073 828..19 4035 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 18:53:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7816484..7816725 103..344 1210 100 Plus
3L 28110227 3L 7817437..7817662 345..570 1130 100 Plus
3L 28110227 3L 7818069..7818224 571..726 780 100 Plus
3L 28110227 3L 7853182..7853285 725..828 505 99 Plus
3L 28110227 3L 7816329..7816412 19..102 420 100 Plus
Blast to na_te.dros performed on 2015-02-04 18:53:44 has no hits.

BO01446.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:30 Download gff for BO01446.3prime
Subject Subject Range Query Range Percent Splice Strand
Pdp1-PB 1..813 15..828 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:29 Download gff for BO01446.3prime
Subject Subject Range Query Range Percent Splice Strand
CG17888-PA 1..813 15..828 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:12:08 Download gff for BO01446.3prime
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 2264..3076 15..828 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:27:18 Download gff for BO01446.3prime
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 2264..3076 15..828 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:27:18 Download gff for BO01446.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 7853183..7853285 726..828 99   Plus
3L 7818069..7818223 571..725 100 <- Plus
3L 7817437..7817662 345..570 100 <- Plus
3L 7816484..7816725 103..344 100 <- Plus
3L 7816326..7816412 15..102 97 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:12:08 Download gff for BO01446.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7846283..7846385 726..828 99   Plus
arm_3L 7811169..7811323 571..725 100 <- Plus
arm_3L 7810537..7810762 345..570 100 <- Plus
arm_3L 7809584..7809825 103..344 100 <- Plus
arm_3L 7809426..7809512 15..102 97 <- Plus

BO01446.5prime Sequence

823 bp (743 high quality bases) assembled on 2005-11-30

> BO01446.5prime
GAAGTTATCAGTCGACATGAGCGACAGGGAGCGATCGTCCCCAACACTGA
TCGAAACTGGTTTAAAAAACTTAATTGGCGGCCGTGATGGTAATTACCCA
CTGATCAGCGGCATTAATGGCAAATCCACATCGAATAGCAAAGAGATCAT
CTGCCCAGATGACAAATACAAGGAGGAGGGCGACATCTGGAATGTTGAGG
CGCAAACAGCGTTTCTCGGCCCAAATCTGTGGGACAAGACCCTGCCCTAT
GATGCCGACCTCAAGGTAACACAATATGCCGACCTAGACGAATTCCTGTC
GGAGAACAACATACCTGATGGCCTGCCCGGCACGCATCTGGGCCACTCCA
GTGGCCTGGGCCACCGGTCCGATTCCCTGGGTCACGCAGCGGGTCTGTCT
CTTGGTCTTGGCCACATAACCACAAAGCGAGAGCGGTCGCCCTCGCCATC
CGACTGCATCAGTCCGGACACGCTAAATCCGCCATCGCCGGCCGAGTCAA
CATTTTCGTTCGCCTCCTCGGGCCGTGACTTTGATCCGCGAACCAGAGCC
TTCTCCGACGAGGAGCTCAAGCCGCAGCCGATGATCAAAAAGTCACGCAA
GCAATTCGTTCCAGATGAGCTCAAGGACGACAAGTACTGGGCACGTCGCC
GGAAGAACAACATTGCCGCCAAGCGATCCCGCGATGCCCGGCGCCAGAAG
GAGAACCAGATTGCGATGCGGGCACGCTACTTGGAGAAGGAAAATGNCAC
ATTACATCANGAGGTGGAGCAGTTGAAACAGGAGAACATGGACTTGCGTG
CACGTCTATCGAAATTCCAAGAT

BO01446.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG17888-PB 813 Pdp1-RB 1..807 17..823 3972 99.6 Plus
CG17888-PA 813 Pdp1-RA 1..807 17..823 3972 99.6 Plus
CG17888-PG 855 Pdp1-RG 145..849 119..823 3462 99.5 Plus
CG17888-PE 855 Pdp1-RE 145..849 119..823 3462 99.5 Plus
CG17888-PF 753 Pdp1-RF 43..747 119..823 3462 99.5 Plus
CG17888-PD 1944 Pdp1-RD 1234..1938 119..823 3462 99.5 Plus
CG17888-PH 1062 Pdp1-RH 352..1056 119..823 3462 99.5 Plus
CG17888-PC 1713 Pdp1-RC 1003..1707 119..823 3462 99.5 Plus
CG17888-PG 855 Pdp1-RG 1..106 17..122 530 100 Plus
CG17888-PE 855 Pdp1-RE 1..106 17..122 530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:15:35
Subject Length Description Subject Range Query Range Score Percent Strand
Pdp1-RK 6855 CG17888-RK 1175..1981 17..823 3998 99.6 Plus
Pdp1-RP 6398 CG17888-RP 1175..1981 17..823 3998 99.6 Plus
Pdp1-RB 5065 CG17888-RB 2264..3070 17..823 3998 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:15:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7816484..7816725 742..501 1210 100 Minus
3L 28110227 3L 7817437..7817662 500..275 1130 100 Minus
3L 28110227 3L 7818069..7818224 274..119 780 100 Minus
3L 28110227 3L 7853182..7853285 120..17 520 100 Minus
3L 28110227 3L 7816332..7816406 823..749 364 98.7 Minus
Blast to na_te.dros performed on 2015-02-13 16:15:33 has no hits.

BO01446.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:31 Download gff for BO01446.5prime
Subject Subject Range Query Range Percent Splice Strand
Pdp1-PA 1..807 17..823 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:31 Download gff for BO01446.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17888-PA 1..807 17..823 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:57:27 Download gff for BO01446.5prime
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 2264..3070 17..823 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:25:18 Download gff for BO01446.5prime
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 2264..3070 17..823 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:25:18 Download gff for BO01446.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 7853183..7853285 17..119 100   Minus
3L 7818069..7818223 120..274 100 <- Minus
3L 7817437..7817662 275..500 100 <- Minus
3L 7816484..7816725 501..742 100 <- Minus
3L 7816332..7816412 743..823 96 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:57:27 Download gff for BO01446.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7846283..7846385 17..119 100   Minus
arm_3L 7811169..7811323 120..274 100 <- Minus
arm_3L 7810537..7810762 275..500 100 <- Minus
arm_3L 7809584..7809825 501..742 100 <- Minus
arm_3L 7809432..7809512 743..823 96 <- Minus

BO01446.complete Sequence

844 bp (844 high quality bases) assembled on 2005-06-23

GenBank Submission: KX796304

> BO01446.complete
GAAGTTATCAGTCGACATGAGCGACAGGGAGCGATCGTCCCCAACACTGA
TCGAAACTGGTTTAAAAAACTTAATTGGCGGCCGTGATGGTAATTACCCA
CTGATCAGCGGCATTAATGGCAAATCCACATCGAATAGCAAAGAGATCAT
CTGCCCAGATGACAAATACAAGGAGGAGGGCGACATCTGGAATGTTGAGG
CGCAAACAGCGTTTCTCGGCCCAAATCTGTGGGACAAGACCCTGCCCTAT
GATGCCGACCTCAAGGTAACACAATATGCCGACCTAGACGAATTCCTGTC
GGAGAACAACATACCTGATGGCCTGCCCGGCACGCATCTGGGCCACTCCA
GTGGCCTGGGCCACCGGTCCGATTCCCTGGGTCACGCAGCGGGTCTGTCT
CTTGGTCTTGGCCACATAACCACAAAGCGAGAGCGGTCGCCCTCGCCATC
CGACTGCATCAGTCCGGACACGCTAAATCCGCCATCGCCGGCCGAGTCAA
CATTTTCGTTCGCCTCCTCGGGCCGTGACTTTGATCCGCGAACCAGAGCC
TTCTCCGACGAGGAGCTCAAGCCGCAGCCGATGATCAAAAAGTCACGCAA
GCAATTCGTTCCAGATGAGCTCAAGGACGACAAGTACTGGGCACGTCGCC
GGAAGAACAACATTGCCGCCAAGCGATCCCGCGATGCCCGGCGCCAGAAG
GAGAACCAGATTGCGATGCGGGCACGCTACTTGGAGAAGGAAAATGCAAC
ATTACATCAGGAGGTGGAGCAGTTGAAACAGGAGAACATGGACTTGCGTG
CACGTCTATCGAAATTCCAAGATGTGGCAAGCTTTCTAGACCAT

BO01446.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
Pdp1-RK 813 CG17888-PK 1..810 17..826 4050 100 Plus
Pdp1-RP 813 CG17888-PP 1..810 17..826 4050 100 Plus
Pdp1-RB 813 CG17888-PB 1..810 17..826 4050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
Pdp1-RK 6855 CG17888-RK 1175..1984 17..826 4050 100 Plus
Pdp1-RP 6398 CG17888-RP 1175..1984 17..826 4050 100 Plus
Pdp1-RB 5065 CG17888-RB 2264..3073 17..826 4050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7816484..7816725 742..501 1210 100 Minus
3L 28110227 3L 7817437..7817662 500..275 1130 100 Minus
3L 28110227 3L 7818069..7818224 274..119 780 100 Minus
3L 28110227 3L 7853182..7853285 120..17 520 100 Minus
3L 28110227 3L 7816329..7816412 826..743 420 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:37:26 has no hits.

BO01446.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:10 Download gff for BO01446.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 1..813 17..830 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:00:44 Download gff for BO01446.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 1173..1982 17..828 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:18 Download gff for BO01446.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 2264..3073 17..828 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:10 Download gff for BO01446.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 1173..1985 17..830 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:21:45 Download gff for BO01446.complete
Subject Subject Range Query Range Percent Splice Strand
Pdp1-RB 2264..3073 17..828 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:21:45 Download gff for BO01446.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7853183..7853285 17..119 100   Minus
3L 7818069..7818223 120..274 100 <- Minus
3L 7817437..7817662 275..500 100 <- Minus
3L 7816484..7816725 501..742 100 <- Minus
3L 7816327..7816412 743..828 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:18 Download gff for BO01446.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7846283..7846385 17..119 100   Minus
arm_3L 7811169..7811323 120..274 100 <- Minus
arm_3L 7810537..7810762 275..500 100 <- Minus
arm_3L 7809584..7809825 501..742 100 <- Minus
arm_3L 7809427..7809512 743..828 97 <- Minus

BO01446.pep Sequence

Translation from 16 to 844

> BO01446.pep
MSDRERSSPTLIETGLKNLIGGRDGNYPLISGINGKSTSNSKEIICPDDK
YKEEGDIWNVEAQTAFLGPNLWDKTLPYDADLKVTQYADLDEFLSENNIP
DGLPGTHLGHSSGLGHRSDSLGHAAGLSLGLGHITTKRERSPSPSDCISP
DTLNPPSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPD
ELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEV
EQLKQENMDLRARLSKFQDVASFLDH

BO01446.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Pdp1-PK 270 CG17888-PK 1..270 1..270 1417 100 Plus
Pdp1-PP 270 CG17888-PP 1..270 1..270 1417 100 Plus
Pdp1-PB 270 CG17888-PB 1..270 1..270 1417 100 Plus
Pdp1-PM 275 CG17888-PM 1..275 1..270 1396 97.8 Plus
Pdp1-PG 284 CG17888-PG 1..284 1..270 1392 95.1 Plus