Clone BO01447 Report

Search the DGRC for BO01447

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptDnz1-RA
Protein status:BO01447.pep:
Sequenced Size:862

Clone Sequence Records

BO01447.3prime Sequence

860 bp (818 high quality bases) assembled on 2005-11-30

> BO01447.3prime
ATGGTCTAGAAAGCTTGCGACCTCGTGGCTCAGTAGAGGCGTATCATGGT
AGCGGGAGGCATGATTGAGACTGGTGCAGGGCAGCAGCCACAGCGCCGGA
TGTCCGCGTCCGAACACATCCGCCAGCAGCTGGTACTTGCGCCGATTTGG
ACGATAGGTGCCCTTCTGCTGTATCGCCTCCACGGCCGTCTCGTCGTACA
GAATCGCATGCAGCTGGTCCACCATGATGGCCGTAACGAACAGGCCGAAC
AGCGCCGACACCAGCATAAGGATAACCGAGTGAATCATTCGCAACTGGGT
TTCGATCACGTTCTGGCTGCACTCCTCGCAGGGCCACACCCAGGAACCGA
CGATAAGGGCAATGGAGTAGAGCGACAGCAGCGCCACGTAGATGAGGAAC
TGCAGGAAGTACTTCTGATTGCGCTCGCCCACACAGTTGTTGATCCAGGG
GCAGTGGTGATCCATGCGCCGGATGCACCGCTTGCAGATGCGACAATGAT
GGGCGCGTGGCGGCCTATACGTTTCGCAGCGGGTGCACACGGTCCATTCG
CTGCTGTGTCCATTACCGGGCGGAGGATTGTTTTTGTTGGTCGTGTGCAG
GTCGGAGAAGTCCAGACGATTGGCGGGCAGCGGCACAGTGCCTGGATCGG
AGAACACGGCCTTGGAGTGGGACATGGCCAACAGGAAGACGACGGTGTTA
AAGAGCACCACATGGAAGGACATCCAGAGGCTGCCCGGCATGGTGGTCAG
AATGATCCAACGGATGACCACATAGTCCGCGTACAGAACTGCTCCGTAGG
TGACTACCAAGCAGGCGATGCCACAGGGATCTCGGATAAAAACCATGTCG
ACTGATAACT

BO01447.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG6627-PA 831 Dnz1-RA 1..828 846..19 4140 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dnz1-RA 1949 CG6627-RA 367..1194 846..19 4140 100 Minus
CG8314-RA 1280 CG8314-RA 536..637 508..407 180 78.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10855654..10856101 286..733 2240 100 Plus
2L 23513712 2L 10855190..10855457 19..286 1340 100 Plus
2L 23513712 2L 10856163..10856278 731..846 580 100 Plus
Blast to na_te.dros performed on 2015-02-11 02:09:47 has no hits.

BO01447.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:32 Download gff for BO01447.3prime
Subject Subject Range Query Range Percent Splice Strand
Dnz1-PA 1..831 18..846 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:33 Download gff for BO01447.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6627-PA 1..831 18..846 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:43:43 Download gff for BO01447.3prime
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 363..1194 19..853 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:44:36 Download gff for BO01447.3prime
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 363..1194 19..853 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 04:44:36 Download gff for BO01447.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 10856163..10856282 731..853 97   Plus
2L 10855655..10856098 287..730 100 <- Plus
2L 10855190..10855457 19..286 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:43:43 Download gff for BO01447.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10856163..10856282 731..853 97   Plus
arm_2L 10855655..10856098 287..730 100 <- Plus
arm_2L 10855190..10855457 19..286 100 <- Plus

BO01447.5prime Sequence

832 bp (819 high quality bases) assembled on 2005-11-30

> BO01447.5prime
GAAGTTATCAGTCGACATGGTTTTTATCCGAGATCCCTGTGGCATCGCCT
GCTTGGTAGTCACCTACGGAGCAGTTCTGTACGCGGACTATGTGGTCATC
CGTTGGATCATTCTGACCACCATGCCGGGCAGCCTCTGGATGTCCTTCCA
TGTGGTGCTCTTTAACACCGTCGTCTTCCTGTTGGCCATGTCCCACTCCA
AGGCCGTGTTCTCCGATCCAGGCACTGTGCCGCTGCCCGCCAATCGTCTG
GACTTCTCCGACCTGCACACGACCAACAAAAACAATCCTCCGCCCGGTAA
TGGACACAGCAGCGAATGGACCGTGTGCACCCGCTGCGAAACGTATAGGC
CGCCACGCGCCCATCATTGTCGCATCTGCAAGCGGTGCATCCGGCGCATG
GATCACCACTGCCCCTGGATCAACAACTGTGTGGGCGAGCGCAATCAGAA
GTACTTCCTGCAGTTCCTCATCTACGTGGCGCTGCTGTCGCTCTACTCCA
TTGCCCTTATCGTCGGTTCCTGGGTGTGGCCCTGCGAGGAGTGCAGCCAG
AACGTGATCGAAACCCAGTTGCGAATGATTCACTCGGTTATCCTTATGCT
GGTGTCGGCGCTGTTCGGCCTGTTCGTTACGGCCATCATGGTGGACCAGC
TGCATGCGATTCTGTACGACGAGACGGCCGTGGAGGCGATACAGCAGAAG
GGCACCTATCGTCCAAATCGGCGCAAGTACCAGCTGCTGGCGGATGTGTT
CGGACGCGGACATCCGGCGCTGTGGCTGCTGCCCTGCACCAGTCTCAATC
ATGCCTCCCGCTACCATGATACGCCTCTACTG

BO01447.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG6627-PA 831 Dnz1-RA 1..816 17..832 4080 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dnz1-RA 1949 CG6627-RA 367..1182 17..832 4080 100 Plus
CG8314-RA 1280 CG8314-RA 536..637 355..456 180 78.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:21:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10855654..10856101 577..130 2240 100 Minus
2L 23513712 2L 10855202..10855457 832..577 1280 100 Minus
2L 23513712 2L 10856163..10856278 132..17 580 100 Minus
Blast to na_te.dros performed on 2015-02-11 04:21:49 has no hits.

BO01447.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:33 Download gff for BO01447.5prime
Subject Subject Range Query Range Percent Splice Strand
Dnz1-PA 1..816 17..832 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:34 Download gff for BO01447.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6627-PA 1..816 17..832 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 05:01:25 Download gff for BO01447.5prime
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 363..1182 10..832 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:03:18 Download gff for BO01447.5prime
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 363..1182 10..832 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:03:18 Download gff for BO01447.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 10856163..10856282 10..132 97   Minus
2L 10855655..10856098 133..576 100 <- Minus
2L 10855202..10855457 577..832 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 05:01:25 Download gff for BO01447.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10856163..10856282 10..132 97   Minus
arm_2L 10855655..10856098 133..576 100 <- Minus
arm_2L 10855202..10855457 577..832 100 <- Minus

BO01447.complete Sequence

862 bp (862 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629501

> BO01447.complete
GAAGTTATCAGTCGACATGGTTTTTATCCGAGATCCCTGTGGCATCGCCT
GCTTGGTAGTCACCTACGGAGCAGTTCTGTACGCGGACTATGTGGTCATC
CGTTGGATCATTCTGACCACCATGCCGGGCAGCCTCTGGATGTCCTTCCA
TGTGGTGCTCTTTAACACCGTCGTCTTCCTGTTGGCCATGTCCCACTCCA
AGGCCGTGTTCTCCGATCCAGGCACTGTGCCGCTGCCCGCCAATCGTCTG
GACTTCTCCGACCTGCACACGACCAACAAAAACAATCCTCCGCCCGGTAA
TGGACACAGCAGCGAATGGACCGTGTGCACCCGCTGCGAAACGTATAGGC
CGCCACGCGCCCATCATTGTCGCATCTGCAAGCGGTGCATCCGGCGCATG
GATCACCACTGCCCCTGGATCAACAACTGTGTGGGCGAGCGCAATCAGAA
GTACTTCCTGCAGTTCCTCATCTACGTGGCGCTGCTGTCGCTCTACTCCA
TTGCCCTTATCGTCGGTTCCTGGGTGTGGCCCTGCGAGGAGTGCAGCCAG
AACGTGATCGAAACCCAGTTGCGAATGATTCACTCGGTTATCCTTATGCT
GGTGTCGGCGCTGTTCGGCCTGTTCGTTACGGCCATCATGGTGGACCAGC
TGCATGCGATTCTGTACGACGAGACGGCCGTGGAGGCGATACAGCAGAAG
GGCACCTATCGTCCAAATCGGCGCAAGTACCAGCTGCTGGCGGATGTGTT
CGGACGCGGACATCCGGCGCTGTGGCTGCTGCCCTGCACCAGTCTCAATC
ATGCCTCCCGCTACCATGATACGCCTCTACTGAGCCACGAGGTCGCAAGC
TTTCTAGACCAT

BO01447.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dnz1-RA 831 CG6627-PA 1..828 17..844 4140 100 Plus
CG8314-RA 882 CG8314-PA 396..497 355..456 180 78.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dnz1-RA 1949 CG6627-RA 367..1194 17..844 4140 100 Plus
CG8314-RA 1280 CG8314-RA 536..637 355..456 180 78.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10855654..10856101 577..130 2240 100 Minus
2L 23513712 2L 10855190..10855457 844..577 1340 100 Minus
2L 23513712 2L 10856163..10856278 132..17 580 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:27:25 has no hits.

BO01447.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:02 Download gff for BO01447.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 1..831 17..845 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:46 Download gff for BO01447.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 388..1219 10..844 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:59:07 Download gff for BO01447.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 367..1194 17..846 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:02 Download gff for BO01447.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 388..1219 10..844 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:19:12 Download gff for BO01447.complete
Subject Subject Range Query Range Percent Splice Strand
Dnz1-RA 367..1194 17..846 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:19:12 Download gff for BO01447.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10856163..10856278 17..132 100   Minus
2L 10855655..10856098 133..576 100 <- Minus
2L 10855188..10855457 577..846 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:59:07 Download gff for BO01447.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10856163..10856278 17..132 100   Minus
arm_2L 10855655..10856098 133..576 100 <- Minus
arm_2L 10855188..10855457 577..846 99 <- Minus

BO01447.pep Sequence

Translation from 16 to 862

> BO01447.pep
MVFIRDPCGIACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFN
TVVFLLAMSHSKAVFSDPGTVPLPANRLDFSDLHTTNKNNPPPGNGHSSE
WTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQF
LIYVALLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHSVILMLVSALF
GLFVTAIMVDQLHAILYDETAVEAIQQKGTYRPNRRKYQLLADVFGRGHP
ALWLLPCTSLNHASRYHDTPLLSHEVASFLDH

BO01447.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dnz1-PA 276 CG6627-PA 1..276 1..276 1504 100 Plus
CG8314-PA 293 CG8314-PA 33..287 4..267 424 32.2 Plus
CG1407-PB 338 CG1407-PB 10..292 5..259 250 25.1 Plus
CG1407-PD 352 CG1407-PD 10..292 5..259 250 25.1 Plus
CG1407-PA 443 CG1407-PA 10..292 5..259 250 25.1 Plus