Clone BO01450 Report

Search the DGRC for BO01450

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptTfIIFbeta-RA
Protein status:BO01450.pep: full length peptide match
Sequenced Size:865

Clone Sequence Records

BO01450.3prime Sequence

862 bp (768 high quality bases) assembled on 2005-11-30

> BO01450.3prime
ATGGTCTAGAAAGCTTGCCTCCGAGTCGCTGCTGCCTGACTTGTGCTCCT
CCTCTTTCTTCTCTTCAGTCTTGTAGTGGCGATATTCTTTCTTGAGCTCC
CACATGTTCTTGTGCGGGTTCTTCATATTGTAATCGCAGACATCCTTGAG
AATCTCCTTCAGGTAGCTAATCGGCTGGTTGGTGATCTTGACCAGATCCT
TGATGTTATAGTATTGATGCTTCTCGAATGCGTGGAAGAGCATATCCATC
ACGGCATTCTTGTCGTCGCGCGCCTTCTTGCCCTCGGCCTTCTTTCGCTC
CCGATATTCAATGTTGTGTGCGTGGTCTTTTACAGGCTTAAAGTTCTGCA
CGATTTTGTCGATAGGCTGCACACGTCGCTGTGGTTCCGATGCCTTGCGT
ATGGACTCCAGCTTTAGTTTCATGTAGCAGTTGTCGGCGATGGGTCGGCA
CTCTAGCTTTTGCACAATCCTGCCCTCCATATACAACTTTTCGTTATCCG
GCTGTGCCGCCGAGGTAGTCGAGTTCTCCTTGCCATCGGACGGTGCCATG
TGCGAGAATACGCCGAGCGTCTGCTTGGTGACCTGCGACACGTCCAGGAT
GTGCTCGGTGGGTATTTTCTCCTCGGGATCTAGAGCCAAAACGGCGGGCG
TGAGGGAAAGCGAGACCTGGGCCTTTTGGCCAGGTGTCTTGTTTATCCGG
AGCTTGCCCACGTCCATGTTCGTCGGCGCCTTCTCCCATTTCTGGGCAAT
GTACTTGGGCACCTTCACCAGCCATACGCCTCGCCCAGCATTGGACAGGT
CCAGGGTCTTGTCGATGATCTGTGTCTTTCCTTTATCTCCTTCGACATGT
CGACTGAATACT

BO01450.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG6538-PA 834 TfIIFbeta-RA 21..831 829..19 4005 99.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 12:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFbeta-RA 1118 CG6538-RA 106..936 848..19 4070 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 12:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10767163..10767699 313..848 2575 99.1 Plus
3R 32079331 3R 10766804..10767097 19..312 1470 100 Plus
Blast to na_te.dros performed on 2015-02-13 12:22:52 has no hits.

BO01450.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:36 Download gff for BO01450.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6538-PA 1..834 18..848 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:38 Download gff for BO01450.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6538-PA 1..834 18..848 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:35:10 Download gff for BO01450.3prime
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 98..943 10..856 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:34:46 Download gff for BO01450.3prime
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 98..943 10..856 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:34:46 Download gff for BO01450.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 10767163..10767703 313..856 98   Plus
3R 10766797..10767097 10..312 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:35:10 Download gff for BO01450.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6592885..6593425 313..856 98   Plus
arm_3R 6592519..6592819 10..312 98 <- Plus

BO01450.5prime Sequence

751 bp (750 high quality bases) assembled on 2005-11-30

> BO01450.5prime
GAAGTTATCAGTCGACATGTCGAAGGAGGATAAGGAAAAGACACAGATCA
TCGACAAGGACCTGGACCTGTCCAATGCTGGGCGAGGCGTATGGCTGGTG
AAGGTGCCCAAGTACATTGCCCAGAAATGGGAGAAGGCGCCGACGAACAT
GGACGTGGGCAAGCTCCGGATAAACAAGACACCTGGCCAAAAGGCCCAGG
TCTCGCTTTCCCTCACGCCCGCCGTTTTGGCTCTAGATCCCGAGGAGAAA
ATACCCACCGAGCACATCCTGGACGTGTCGCAGGTCACCAAGCAGACGCT
CGGCGTATTCTCGCACATGGCACCGTCCGATGGCAAGGAGAACTCGACTA
CCTCGGCGGCACAGCCGGATAACGAAAAGTTGTATATGGAGGGCAGGATT
GTGCAAAAGCTAGAGTGCCGACCCATCGCCGACAACTGCTACATGAAACT
AAAGCTGGAGTCCATACGCAAGGCATCGGAACCACAGCGACGTGTGCAGC
CTATCGACAAAATCGTGCAGAACTTTAAGCCTGTAAAAGACCACGCACAC
AACATTGAATATCGGGAGCGAAAGAAGGCCGAGGGCAAGAAGGCGCGCGA
CGACAAGAATGCCGTGATGGATATGCTCTTCCACGCATTCGAGAAGCATC
AATACTATAACATCAAGGATCTGGTCAAGATCACCAACCAGCCGATTAGC
TACCTGAAGGAGATTCTCAAGGATGTCTGCGATTACAATATGAAGAACCC
G

BO01450.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG6538-PA 834 TfIIFbeta-RA 1..735 17..751 3675 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 12:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFbeta-RA 1118 CG6538-RA 106..840 17..751 3675 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 12:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10767163..10767699 553..17 2685 100 Minus
3R 32079331 3R 10766900..10767097 751..554 990 100 Minus
Blast to na_te.dros performed on 2015-02-13 12:23:00 has no hits.

BO01450.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:37 Download gff for BO01450.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6538-PA 1..735 17..751 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:40 Download gff for BO01450.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6538-PA 1..735 17..751 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:35:13 Download gff for BO01450.5prime
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 98..840 9..751 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:34:52 Download gff for BO01450.5prime
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 98..840 9..751 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:34:52 Download gff for BO01450.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 10767163..10767703 9..553 99   Minus
3R 10766900..10767097 554..751 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:35:13 Download gff for BO01450.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6592885..6593425 9..553 99   Minus
arm_3R 6592622..6592819 554..751 100 <- Minus

BO01450.complete Sequence

865 bp (865 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629502

> BO01450.complete
GAAGTTATCAGTCGACATGTCGAAGGAGGATAAGGAAAAGACACAGATCA
TCGACAAGGACCTGGACCTGTCCAATGCTGGGCGAGGCGTATGGCTGGTG
AAGGTGCCCAAGTACATTGCCCAGAAATGGGAGAAGGCGCCGACGAACAT
GGACGTGGGCAAGCTCCGGATAAACAAGACACCTGGCCAAAAGGCCCAGG
TCTCGCTTTCCCTCACGCCCGCCGTTTTGGCTCTAGATCCCGAGGAGAAA
ATACCCACCGAGCACATCCTGGACGTGTCGCAGGTCACCAAGCAGACGCT
CGGCGTATTCTCGCACATGGCACCGTCCGATGGCAAGGAGAACTCGACTA
CCTCGGCGGCACAGCCGGATAACGAAAAGTTGTATATGGAGGGCAGGATT
GTGCAAAAGCTAGAGTGCCGACCCATCGCCGACAACTGCTACATGAAACT
AAAGCTGGAGTCCATACGCAAGGCATCGGAACCACAGCGACGTGTGCAGC
CTATCGACAAAATCGTGCAGAACTTTAAGCCTGTAAAAGACCACGCACAC
AACATTGAATATCGGGAGCGAAAGAAGGCCGAGGGCAAGAAGGCGCGCGA
CGACAAGAATGCCGTGATGGATATGCTCTTCCACGCATTCGAGAAGCATC
AATACTATAACATCAAGGATCTGGTCAAGATCACCAACCAGCCGATTAGC
TACCTGAAGGAGATTCTCAAGGATGTCTGCGATTACAATATGAAGAACCC
GCACAAGAACATGTGGGAGCTCAAGAAAGAATATCGCCACTACAAGACTG
AAGAGAAGAAAGAGGAGGAGCACAAGTCAGGCAGCAGCGACTCGGAGGCA
AGCTTTCTAGACCAT

BO01450.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFbeta-RA 834 CG6538-PA 1..831 17..847 4155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFbeta-RA 1118 CG6538-RA 106..936 17..847 4155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10767163..10767699 553..17 2685 100 Minus
3R 32079331 3R 10766804..10767097 847..554 1470 100 Minus
Blast to na_te.dros performed on 2014-11-27 20:58:57 has no hits.

BO01450.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:03 Download gff for BO01450.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 1..834 17..848 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:48 Download gff for BO01450.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 240..1085 9..856 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:14:01 Download gff for BO01450.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 106..936 17..849 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:04 Download gff for BO01450.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 240..1085 9..856 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:32:18 Download gff for BO01450.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFbeta-RA 106..936 17..849 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:32:18 Download gff for BO01450.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10767163..10767699 17..553 100   Minus
3R 10766800..10767097 554..849 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:14:01 Download gff for BO01450.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6592885..6593421 17..553 100   Minus
arm_3R 6592522..6592819 554..849 99 <- Minus

BO01450.pep Sequence

Translation from 16 to 865

> BO01450.pep
MSKEDKEKTQIIDKDLDLSNAGRGVWLVKVPKYIAQKWEKAPTNMDVGKL
RINKTPGQKAQVSLSLTPAVLALDPEEKIPTEHILDVSQVTKQTLGVFSH
MAPSDGKENSTTSAAQPDNEKLYMEGRIVQKLECRPIADNCYMKLKLESI
RKASEPQRRVQPIDKIVQNFKPVKDHAHNIEYRERKKAEGKKARDDKNAV
MDMLFHAFEKHQYYNIKDLVKITNQPISYLKEILKDVCDYNMKNPHKNMW
ELKKEYRHYKTEEKKEEEHKSGSSDSEASFLDH

BO01450.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFbeta-PA 277 CG6538-PA 1..277 1..277 1453 100 Plus