Clone BO01454 Report

Search the DGRC for BO01454

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptMED27-RA
Protein status:BO01454.pep: full length peptide match
Sequenced Size:913

Clone Sequence Records

BO01454.3prime Sequence

800 bp (759 high quality bases) assembled on 2005-11-30

> BO01454.3prime
ATGGTCTAGAAAGCTTGCGCAATTTCGGCAGTCCTCGTGGAAGGGTTCTA
GAGTGCGCAGGTCCCGCCACGTCGGAGGCAATCCGTTCACCACGAATTTC
CCACAACGCTTGCAGGGCTCCAGGAAAAGTTTGACGTGGCTGTTCAGCCA
GGTTATATAGCTTTTCACTGCCAGATCGGGCAACGTCGGCGAAAAGAAAT
GCAGCATTGCTGAGTGAGCATGATCCTGGACTTTGCGGAACACCTCGTAA
CGTGACTCGGCCCACAGGTCGTCATGCTCCAGCGGCTCATCGAATCCCTT
AACCGTAACCCACTCTATAAGCACTCCTTTGAAGACAATAGCCGCCTTCA
TCACGTTACTTATTGTTACGATGGTGACAGCGTTTGTGCCGAAGGGACGA
AAAATTCTGTACGAAGTATGCGGAGGGGTGTTGATCTCACTCAGGAGCTT
ATCTATGTGGTCTGGATCGTTGTTGAAGGACGAGAAGGGCAGTCGCTGGC
GCTTCTGCGAGCAGTAATTGTAGGAGCGCCTGAGTGTGTTCTGGTTGAGA
TTGTTGAAGGCCAAGAAGCTGTGGTCGTGCACCTTGTCCATCCACTTGTA
GCTGTTCACCAGCTGAGGGTATAGAGCCTGTCGATCCTGCGAAGTTTCCT
GCGCCAGGTAGGCGGTGTTCCCGAGAGAATAGGGTGTTGGTGGCACCGGC
AGTCCATTAATCAGCTGCTCTACCTCACGTATTTGCGAGTTGATGGCTGC
GAATCTCTCCTGGAAGTCATTTACGAACTTATTCCGGCTCTCCCTCGCGC

BO01454.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG1245-PA 882 MED27-RA 105..879 793..19 3875 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
MED27-RA 1080 CG1245-RA 172..946 793..19 3875 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5655761..5656202 460..19 2210 100 Minus
3R 32079331 3R 5655433..5655700 728..461 1340 100 Minus
3R 32079331 3R 5655310..5655375 793..728 330 100 Minus
Blast to na_te.dros performed on 2015-02-12 05:50:17 has no hits.

BO01454.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:40 Download gff for BO01454.3prime
Subject Subject Range Query Range Percent Splice Strand
MED27-PA 98..882 15..800 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:44 Download gff for BO01454.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1245-PA 98..882 15..800 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:18:17 Download gff for BO01454.3prime
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 165..954 10..800 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:57:05 Download gff for BO01454.3prime
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 165..954 10..800 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:57:05 Download gff for BO01454.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 5655761..5656210 10..460 99   Minus
3R 5655434..5655700 461..727 100 -> Minus
3R 5655303..5655375 728..800 97 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:18:17 Download gff for BO01454.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1481483..1481932 10..460 99   Minus
arm_3R 1481156..1481422 461..727 100 -> Minus
arm_3R 1481025..1481097 728..800 97 -> Minus

BO01454.5prime Sequence

839 bp (677 high quality bases) assembled on 2005-11-30

> BO01454.5prime
GAAGTTATCAGTCGACATGGATAAGTTAAATTCCACTCTAACTGCCGTCA
AAAACCTGCGGTCCAACGTAAGGCTGTGCTTCGAGCACCTGGCCGATGGA
ACCGATGGGGAGAGCGGCGAGGAGAGCCGGAATAAGTTCGTAAATGACTT
CCAGGAGAGATTCGCAGCCATCAACTCGCAAATACGTGAGGTAGAGCAGC
TGATTAATGGACTGCCGGTGCCACCAACACCCTATTCTCTCGGGAACACC
GCCTACCTGGCGCAGGAAACTTCGCAGGATCGACAGGCTCTATACCCTCA
GCTGGTGAACAGCTACAAGTGGATGGACAAGGTGCACGACCACAGCTTCT
TGGCCTTCAACAATCTCAACCAGAACACACTCAGGCGCTCCTACAATTAC
TGCTCGCAGAAGCGCCAGCGACTGCCCTTCTCGTCCTTCAACAACGATCC
AGACCACATAGATAAGCTCCTGAGTGAGATCAACACCCCTCCGCATACTT
CGTACAGAATTTTTCGTCCCTTCGGCACAAACGCTGTCACCATCGTAACA
ATAAGTAACGTGATGAAGGCGGCTATTGTCTTCAAAGGAGTGCTTATAGA
GTGGGTTACGGTTAAGGGATTCGATGAGCCGCTGGAGCATGACGACCTGT
GGGCCGAGTCACGTTACGAGGTGTTCCGCAAAGTCCAGGATCATGCTCAC
TCAGCAATGCTGCATTTCTTTTCGCCGACGTTGCCCGATCTGGCAGTGAA
AAGCTATATAACCTGGCTGAACAGCCACGTCAAACTTTTCCTGAAGCCCT
GCAAGCGTTGTGGGAAATTCGTGGTGAAACGATTGCCTC

BO01454.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG1245-PA 882 MED27-RA 1..823 17..839 4040 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:36:33
Subject Length Description Subject Range Query Range Score Percent Strand
MED27-RA 1080 CG1245-RA 68..890 17..839 4070 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:36:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5655761..5656146 454..839 1885 99.2 Plus
3R 32079331 3R 5655433..5655700 186..453 1340 100 Plus
3R 32079331 3R 5655206..5655375 17..186 850 100 Plus
Blast to na_te.dros performed on 2015-02-12 00:36:30 has no hits.

BO01454.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:41 Download gff for BO01454.5prime
Subject Subject Range Query Range Percent Splice Strand
MED27-PA 1..823 17..839 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:45 Download gff for BO01454.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1245-PA 1..823 17..839 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:32:01 Download gff for BO01454.5prime
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 64..890 13..839 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 02:11:08 Download gff for BO01454.5prime
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 64..890 13..839 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 02:11:08 Download gff for BO01454.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 5655761..5656146 454..839 99   Plus
3R 5655434..5655700 187..453 100 -> Plus
3R 5655202..5655375 13..186 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:32:01 Download gff for BO01454.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1481483..1481868 454..839 99   Plus
arm_3R 1481156..1481422 187..453 100 -> Plus
arm_3R 1480924..1481097 13..186 98 -> Plus

BO01454.complete Sequence

913 bp (913 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629503

> BO01454.complete
GAAGTTATCAGTCGACATGGATAAGTTAAATTCCACTCTAACTGCCGTCA
AAAACCTGCGGTCCAACGTAAGGCTGTGCTTCGAGCACCTGGCCGATGGA
ACCGATGGGGAGAGCGGCGAGGAGAGCCGGAATAAGTTCGTAAATGACTT
CCAGGAGAGATTCGCAGCCATCAACTCGCAAATACGTGAGGTAGAGCAGC
TGATTAATGGACTGCCGGTGCCACCAACACCCTATTCTCTCGGGAACACC
GCCTACCTGGCGCAGGAAACTTCGCAGGATCGACAGGCTCTATACCCTCA
GCTGGTGAACAGCTACAAGTGGATGGACAAGGTGCACGACCACAGCTTCT
TGGCCTTCAACAATCTCAACCAGAACACACTCAGGCGCTCCTACAATTAC
TGCTCGCAGAAGCGCCAGCGACTGCCCTTCTCGTCCTTCAACAACGATCC
AGACCACATAGATAAGCTCCTGAGTGAGATCAACACCCCTCCGCATACTT
CGTACAGAATTTTTCGTCCCTTCGGCACAAACGCTGTCACCATCGTAACA
ATAAGTAACGTGATGAAGGCGGCTATTGTCTTCAAAGGAGTGCTTATAGA
GTGGGTTACGGTTAAGGGATTCGATGAGCCGCTGGAGCATGACGACCTGT
GGGCCGAGTCACGTTACGAGGTGTTCCGCAAAGTCCAGGATCATGCTCAC
TCAGCAATGCTGCATTTCTTTTCGCCGACGTTGCCCGATCTGGCAGTGAA
AAGCTATATAACCTGGCTGAACAGCCACGTCAAACTTTTCCTGGAGCCCT
GCAAGCGTTGTGGGAAATTCGTGGTGAACGGATTGCCTCCGACGTGGCGG
GACCTGCGCACTCTAGAACCCTTCCACGAGGACTGCCGAAATTGCGCAAG
CTTTCTAGACCAT

BO01454.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
MED27-RA 882 CG1245-PA 1..879 17..895 4395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
MED27-RA 1080 CG1245-RA 68..946 17..895 4395 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5655761..5656202 454..895 2210 100 Plus
3R 32079331 3R 5655433..5655700 186..453 1340 100 Plus
3R 32079331 3R 5655206..5655375 17..186 850 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:26:50 has no hits.

BO01454.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:05 Download gff for BO01454.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 1..882 17..899 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:50 Download gff for BO01454.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 58..948 13..904 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:00:57 Download gff for BO01454.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 68..946 17..897 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:05 Download gff for BO01454.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 58..948 13..904 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:41:31 Download gff for BO01454.complete
Subject Subject Range Query Range Percent Splice Strand
MED27-RA 68..946 17..897 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:41:31 Download gff for BO01454.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5655761..5656202 454..897 99   Plus
3R 5655434..5655700 187..453 100 -> Plus
3R 5655206..5655375 17..186 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:00:57 Download gff for BO01454.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1481483..1481924 454..897 99   Plus
arm_3R 1481156..1481422 187..453 100 -> Plus
arm_3R 1480928..1481097 17..186 100 -> Plus

BO01454.pep Sequence

Translation from 16 to 913

> BO01454.pep
MDKLNSTLTAVKNLRSNVRLCFEHLADGTDGESGEESRNKFVNDFQERFA
AINSQIREVEQLINGLPVPPTPYSLGNTAYLAQETSQDRQALYPQLVNSY
KWMDKVHDHSFLAFNNLNQNTLRRSYNYCSQKRQRLPFSSFNNDPDHIDK
LLSEINTPPHTSYRIFRPFGTNAVTIVTISNVMKAAIVFKGVLIEWVTVK
GFDEPLEHDDLWAESRYEVFRKVQDHAHSAMLHFFSPTLPDLAVKSYITW
LNSHVKLFLEPCKRCGKFVVNGLPPTWRDLRTLEPFHEDCRNCASFLDH

BO01454.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:37:49
Subject Length Description Subject Range Query Range Score Percent Strand
MED27-PA 293 CG1245-PA 1..293 1..293 1575 100 Plus