Clone BO01456 Report

Search the DGRC for BO01456

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptPop2-RB
Protein status:BO01456.pep: full length peptide match
Sequenced Size:913

Clone Sequence Records

BO01456.3prime Sequence

869 bp (802 high quality bases) assembled on 2005-11-30

> BO01456.3prime
ATGGTCTAGAAAGCTTGCTGAAGCGCTGTTCGTCTCACCGTTGCTGTCGT
GGAAGTTGGTGCCATTGACGATGAAGGAGGTACCCAGGCCGTACAGGTGT
CCGGAGTACTTCGCATGGTCGATGTTGTCCTCGAAGAACATCTCACGCAT
TTTGAAGAAGGCCATGCCCGTCAGCAGAGCATCCGAGCCGGCCTGATGCT
GGGGGCCCACGCGCCGCAGTTCCAGCTGATCGGCAACCTCCTGCAGGCCG
CCTTTCAGGTTCTTGCACGACTTCATCAGATACTTGATGTCGAAGATGTT
GGGAAAGTAGATGTGCAGCAGATCGAAAAATTCAGATTCGTCCGGGGGCA
GGTTCTGATCGGTGAGCAGCTTTAGAAGGTAGCCAAAATCGTAGCCGGAG
TGGAAGCACAGCCACTTGATGTTTTCCACCAGCACGATGCCAGAGCTCAT
CAGCAGTTCGGCGAAGTCGATGGGATCGATGCCATCCTCCTCGTGCTTCT
TGAACTGAATTCCGGAGTTCTGCAGCAGATCGATCGAGTCCTGCGCATAC
ATGTCCTCGCTCAGGTTAAACTTGAAGTTGAACTGCCAGGTGGAGTAGCC
GGGTGGTGTCTTTCCATCGTCGTCCATGAAGGTAAGGCCCAATTGGATAA
TCCGCAGCAGATCGACATTACAGCGCAGCAGCTGGTAATGATAGTCCGCC
GTGGAGCGGAACTCGCCGACTGGACGTGCTACCACGCCTGGAAACTCGGT
GTCCATGGCCACATAGTGGTACTTCTGCACCACTTTCCGTATGGTGCGGA
ACTCCTCCCTCAGGTTTTGCTTCCACACATCGCGAATGCCGCACTCCTCG
TTGCTGGGTATGTGGGCAT

BO01456.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG5684-PC 882 CG5684-RC 29..879 869..19 4180 99.6 Minus
CG5684-PA 894 CG5684-RA 41..891 869..19 4180 99.6 Minus
CG5684-PB 882 CG5684-RB 29..879 869..19 4180 99.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 18:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
Pop2-RB 1893 CG5684-RB 567..1417 869..19 4210 99.6 Minus
Pop2-RA 1688 CG5684-RA 362..1212 869..19 4210 99.6 Minus
Pop2-RC 1827 CG5684-RC 501..1351 869..19 4210 99.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 18:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12000273..12000692 142..561 2100 100 Plus
3L 28110227 3L 12000750..12001059 560..869 1505 99 Plus
3L 28110227 3L 11998874..11998998 19..143 625 100 Plus
Blast to na_te.dros performed on 2015-02-09 18:17:44 has no hits.

BO01456.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:44 Download gff for BO01456.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5684-PC 29..882 16..869 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:49 Download gff for BO01456.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5684-PB 29..882 16..869 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 03:54:38 Download gff for BO01456.3prime
Subject Subject Range Query Range Percent Splice Strand
Pop2-RC 501..1351 19..869 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:09:43 Download gff for BO01456.3prime
Subject Subject Range Query Range Percent Splice Strand
Pop2-RC 501..1351 19..869 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:09:43 Download gff for BO01456.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 12000750..12001059 560..869 99   Plus
3L 12000273..12000690 142..559 100 <- Plus
3L 11998874..11998996 19..141 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 03:54:38 Download gff for BO01456.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11993850..11994159 560..869 99   Plus
arm_3L 11993373..11993790 142..559 100 <- Plus
arm_3L 11991974..11992096 19..141 100 <- Plus

BO01456.5prime Sequence

823 bp (703 high quality bases) assembled on 2005-11-30

> BO01456.5prime
GAAGTTATCAGTCGACATGCCCTCGGCCATCAGTGGCGCGCCACATGCCC
ACATACCCAGCAACGAGGAGTGCGGCATCCGCGATGTGTGGAAGCAAAAC
CTGGAGGAGGAGTTCCGCACCATACGGAAAGTGGTGCAGAAGTACCACTA
TGTGGCCATGGACACCGAGTTTCCAGGCGTGGTAGCACGTCCAGTCGGCG
AGTTCCGCTCCACGGCGGACTATCATTACCAGCTGCTGCGCTGTAATGTC
GATCTGCTGCGGATTATCCAATTGGGCCTTACCTTCATGGACGACGATGG
AAAGACACCACCCGGCTACTCCACCTGGCAGTTCAACTTCAAGTTTAACC
TGAGCGAGGACATGTATGCGCAGGACTCGATCGATCTGCTGCAGAACTCC
GGAATTCAGTTCAAGAAGCACGAGGAGGATGGCATCGATCCCATCGACTT
CGCCGAACTGCTGATGAGCTCTGGCATCGTGCTGGTGGAAAACATCAAGT
GGCTGTGCTTCCACTCCGGCTACGATTTTGGCTACCTTCTAAAGCTGCTC
ACCGATCAGAACCTGCCCCCGGACGAATCTGAATTTTTCGATCTGCTGCA
CATCTACTTTCCCAACATCTTCGACATCAAGTATCTGATGAAGTCGTGCA
AGAACCTGAAAGGCGGCCTGCAGGAGGTTGCCGATCAGCTGGAACTGCGG
CGCGTGGGCCCCCAGCATCAGGCCGGCTCGGATGCTCTGCTGACGGGCAT
GGCCTTCTTCAAATGCGTGAGATGTTCTTCGAGGACAACATCGACCATGC
GAAGTACTCCGGACACCTGTACG

BO01456.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG5684-PC 882 CG5684-RC 1..747 17..763 3735 100 Plus
CG5684-PA 894 CG5684-RA 13..759 17..763 3735 100 Plus
CG5684-PB 882 CG5684-RB 1..747 17..763 3735 100 Plus
CG5684-PC 882 CG5684-RC 746..808 761..823 315 100 Plus
CG5684-PA 894 CG5684-RA 758..820 761..823 315 100 Plus
CG5684-PB 882 CG5684-RB 746..808 761..823 315 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:15:50
Subject Length Description Subject Range Query Range Score Percent Strand
Pop2-RB 1893 CG5684-RB 539..1346 17..823 4015 99.9 Plus
Pop2-RA 1688 CG5684-RA 334..1141 17..823 4015 99.9 Plus
Pop2-RC 1827 CG5684-RC 473..1280 17..823 4015 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:15:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12000282..12000692 763..353 2055 100 Minus
3L 28110227 3L 12000750..12001087 354..17 1690 100 Minus
3L 28110227 3L 11998945..11998998 823..770 270 100 Minus
Blast to na_te.dros performed on 2015-02-13 16:15:49 has no hits.

BO01456.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:45 Download gff for BO01456.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5684-PC 1..808 17..823 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:51 Download gff for BO01456.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5684-PB 1..808 17..823 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:57:31 Download gff for BO01456.5prime
Subject Subject Range Query Range Percent Splice Strand
Pop2-RC 473..1280 17..823 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:26:14 Download gff for BO01456.5prime
Subject Subject Range Query Range Percent Splice Strand
Pop2-RC 473..1280 17..823 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:26:14 Download gff for BO01456.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 12000750..12001090 14..354 99 <- Minus
3L 12000273..12000690 355..771 99 <- Minus
3L 11998945..11998996 772..823 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:57:31 Download gff for BO01456.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11993850..11994190 14..354 99 <- Minus
arm_3L 11993373..11993790 355..771 99 <- Minus
arm_3L 11992045..11992096 772..823 100 <- Minus

BO01456.complete Sequence

913 bp (913 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629504

> BO01456.complete
GAAGTTATCAGTCGACATGCCCTCGGCCATCAGTGGCGCGCCACATGCCC
ACATACCCAGCAACGAGGAGTGCGGCATCCGCGATGTGTGGAAGCAAAAC
CTGGAGGAGGAGTTCCGCACCATACGGAAAGTGGTGCAGAAGTACCACTA
TGTGGCCATGGACACCGAGTTTCCAGGCGTGGTAGCACGTCCAGTCGGCG
AGTTCCGCTCCACGGCGGACTATCATTACCAGCTGCTGCGCTGTAATGTC
GATCTGCTGCGGATTATCCAATTGGGCCTTACCTTCATGGACGACGATGG
AAAGACACCACCCGGCTACTCCACCTGGCAGTTCAACTTCAAGTTTAACC
TGAGCGAGGACATGTATGCGCAGGACTCGATCGATCTGCTGCAGAACTCC
GGAATTCAGTTCAAGAAGCACGAGGAGGATGGCATCGATCCCATCGACTT
CGCCGAACTGCTGATGAGCTCTGGCATCGTGCTGGTGGAAAACATCAAGT
GGCTGTGCTTCCACTCCGGCTACGATTTTGGCTACCTTCTAAAGCTGCTC
ACCGATCAGAACCTGCCCCCGGACGAATCTGAATTTTTCGATCTGCTGCA
CATCTACTTTCCCAACATCTTCGACATCAAGTATCTGATGAAGTCGTGCA
AGAACCTGAAAGGCGGCCTGCAGGAGGTTGCCGATCAGCTGGAACTGCGG
CGCGTGGGCCCCCAGCATCAGGCCGGCTCGGATGCTCTGCTGACGGGCAT
GGCCTTCTTCAAAATGCGTGAGATGTTCTTCGAGGACAACATCGACCATG
CGAAGTACTCCGGACACCTGTACGGCCTGGGTACCTCCTTCATCGTCAAT
GGCACCAACTTCCACGACAGCAACGGTGAGACGAACAGCGCTTCAGCAAG
CTTTCTAGACCAT

BO01456.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
Pop2-RB 882 CG5684-PB 1..879 17..895 4395 100 Plus
Pop2-RA 894 CG5684-PA 13..891 17..895 4395 100 Plus
Pop2-RC 882 CG5684-PC 1..879 17..895 4395 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
Pop2-RB 1893 CG5684-RB 539..1417 17..895 4395 100 Plus
Pop2-RA 1688 CG5684-RA 334..1212 17..895 4395 100 Plus
Pop2-RC 1827 CG5684-RC 473..1351 17..895 4395 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12000273..12000692 772..353 2100 100 Minus
3L 28110227 3L 12000750..12001087 354..17 1690 100 Minus
3L 28110227 3L 11998874..11998998 895..771 625 100 Minus
Blast to na_te.dros performed on 2014-11-28 08:37:20 has no hits.

BO01456.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:06 Download gff for BO01456.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RB 1..882 17..898 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:00:41 Download gff for BO01456.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RB 537..1415 17..897 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:24:15 Download gff for BO01456.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RC 473..1351 17..897 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:06 Download gff for BO01456.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RB 537..1415 17..895 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:21:44 Download gff for BO01456.complete
Subject Subject Range Query Range Percent Splice Strand
Pop2-RC 473..1351 17..897 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:21:44 Download gff for BO01456.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12000750..12001087 17..354 100   Minus
3L 12000273..12000690 355..772 100 <- Minus
3L 11998871..11998996 773..897 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:24:15 Download gff for BO01456.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11993850..11994187 17..354 100   Minus
arm_3L 11993373..11993790 355..772 100 <- Minus
arm_3L 11991971..11992096 773..897 98 <- Minus

BO01456.pep Sequence

Translation from 16 to 913

> BO01456.pep
MPSAISGAPHAHIPSNEECGIRDVWKQNLEEEFRTIRKVVQKYHYVAMDT
EFPGVVARPVGEFRSTADYHYQLLRCNVDLLRIIQLGLTFMDDDGKTPPG
YSTWQFNFKFNLSEDMYAQDSIDLLQNSGIQFKKHEEDGIDPIDFAELLM
SSGIVLVENIKWLCFHSGYDFGYLLKLLTDQNLPPDESEFFDLLHIYFPN
IFDIKYLMKSCKNLKGGLQEVADQLELRRVGPQHQAGSDALLTGMAFFKM
REMFFEDNIDHAKYSGHLYGLGTSFIVNGTNFHDSNGETNSASASFLDH

BO01456.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
Pop2-PB 293 CG5684-PB 1..293 1..293 1568 100 Plus
Pop2-PC 293 CG5684-PC 1..293 1..293 1568 100 Plus
Pop2-PA 297 CG5684-PA 5..297 1..293 1568 100 Plus
Pop2-PD 357 CG5684-PD 1..253 1..253 1346 99.6 Plus
Pop2-PE 361 CG5684-PE 5..257 1..253 1346 99.6 Plus