Clone BO01458 Report

Search the DGRC for BO01458

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG11617-RA
Protein status:BO01458.pep:
Sequenced Size:916

Clone Sequence Records

BO01458.3prime Sequence

878 bp (839 high quality bases) assembled on 2005-11-30

> BO01458.3prime
ATGGTCTAGAAAGCTTGCGATATGGTGCCAGCGCTGCCTGCAGTTGAAGG
CGAGGTTGGCTAAGGCCTCTGCTGCTTCCAGTTCGTCCTTATGATGAAGC
ATCCAGCGTCCACCACGACCAGCCCCAGACACATCTGTGGTAAAGATCGC
TTGTCCACAACTGCTATTACTGCTAGCTTTCTGCCTGGTCATATTCCACT
CGATGTGATAATTGTTCCTGTCCGGTGTGAATTTTGCTGCACTTTCCAGC
CACTTGTTGAGTTGCGTACCCTGTTGACTGGTCGTTTTTGCCGTGGAACT
ATCTCGCATATACTTTTCCATCATCTGATGCTTGTACTTGGTCTTACCCC
CTGTTTGTGCTGATATCCGCTCGGTCAGACCTGCAGATCCTACAAACAAT
ATCGGCTTGTATGGGGATGAAGGTTCATTATTGGCATTGCCATCGCTACC
AGTACTGTGGCTGGAAAACTCTTCATTATCGTCGCCTTCGTCATCCTCCG
CAGGACATGAGTGCATCTCCTCCTCCCAAATGCTATCCTCCGACGAGATG
CTAAATTGTTCCACATTACCCCTTGCATTGTGATTGTAATTTTTGATCAG
ATGGCCCCAGGATTTCTTGGCTTTCTCTCGCTCCGAGTTTTTAAGCTTTC
TTCGCCAGTTTGCAAACCAATTGCAAATCTGAGTGTAAGTAAGTCCAGTC
TCTGCAGCAAGCTGTTTTTTCTCCTCCCTGCTAGGATAGGGATTCTCCCG
GCGACGAATTAACCAGTCCTTTAGCATCCTCTTAATGTCGGGAGTAAATA
ATCTCTTTGTAGCTCGGGATGCTGGATGCAACTCCTCCTCTGGTGGNCAG
GCTCGTCTGCTGTGTCGACGATTTTCTT

BO01458.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG11617-PA 885 CG11617-RA 27..882 874..19 4261 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 21:53:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG11617-RB 1290 CG11617-RB 131..986 874..19 4269 99.9 Minus
CG11617-RA 1259 CG11617-RA 100..955 874..19 4269 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 21:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 205271..205946 184..859 3369 99.9 Plus
2L 23513712 2L 205047..205214 19..186 840 100 Plus
Blast to na_te.dros performed on 2015-02-11 21:53:25 has no hits.

BO01458.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:45 Download gff for BO01458.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11617-PA 23..885 15..878 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:52 Download gff for BO01458.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11617-PA 23..885 15..878 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:32:03 Download gff for BO01458.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 96..960 14..878 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:38:19 Download gff for BO01458.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 96..960 14..878 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 00:38:19 Download gff for BO01458.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 205272..205943 185..856 99 <- Plus
2L 205042..205212 14..184 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:32:03 Download gff for BO01458.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 205272..205943 185..856 99 <- Plus
arm_2L 205042..205212 14..184 98 <- Plus

BO01458.5prime Sequence

847 bp (789 high quality bases) assembled on 2005-11-30

> BO01458.5prime
GAAGTTATCAGTCGACATGGACAAGTCAACGCGGCCTAAACGAAATCGTC
GACACAGCAGACGAGCCTGGCCACCAGAGGAGGAGTTGCATCCAGCATCC
CGAGCTACAAAGAGATTATTTACTCCCGACATTAAGAGGATGCTAAAGGA
CTGGTTAATTCGTCGCCGGGAGAATCCCTATCCTAGCAGGGAGGAGAAAA
AACAGCTTGCTGCAGAGACTGGACTTACTTACACTCAGATTTGCAATTGG
TTTGCAAACTGGCGAAGAAAGCTTAAAAACTCGGAGCGAGAGAAAGCCAA
GAAATCCTGGGGCCATCTGATCAAAAATTACAATCACAATGCAAGGGGTA
ATGTGGAACAATTTAGCATCTCGTCGGAGGATAGCATTTGGGAGGAGGAG
ATGCACTCATGTCCTGCGGAGGATGACGAAGGCGACGATAATGAAGAGTT
TTCCAGCCACAGTACTGGTAGCGATGGCAATGCCAATAATGAACCTTCAT
CCCCATACAAGCCGATATTGTTTGTAGGATCTGCAGGTCTGACCGAGCGG
ATATCAGCACAAACAGGGGGTAAGACCAAGTACAAGCATCAGATGATGGA
AAAGTATATGCGAGATAGTTCCACGGCAAAAACGACCAGTCAACAGGGTA
CGCAACTCAACAAGTGGCTGGAAAGTGCAGCAAAATTCACACCGGACAGG
AACAATTATCACATCGAGTGGAATATGACCAGGCAGAAAGCTAGCAGTAA
TAGCAGTTGTGGACAAGCGATCTTTACCACAGATGTGTCTGGGGCTGGTC
GTGGTGGACGCTGGATGCTTCATCATAAGGACGAACTGGAAGCAGCA

BO01458.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG11617-PA 885 CG11617-RA 1..831 17..847 4155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 18:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11617-RB 1290 CG11617-RB 104..935 16..847 4160 100 Plus
CG11617-RA 1259 CG11617-RA 73..904 16..847 4160 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 18:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 205271..205946 733..58 3380 100 Minus
2L 23513712 2L 205098..205214 847..731 585 100 Minus
2L 23513712 2L 206001..206045 60..16 225 100 Minus
Blast to na_te.dros performed on 2015-02-09 18:17:54 has no hits.

BO01458.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:46 Download gff for BO01458.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11617-PA 1..830 17..846 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:54 Download gff for BO01458.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11617-PA 1..830 17..846 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 03:54:41 Download gff for BO01458.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 73..903 16..846 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:09:44 Download gff for BO01458.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 73..903 16..846 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:09:44 Download gff for BO01458.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 206001..206054 8..60 92   Minus
2L 205272..205943 61..732 100 <- Minus
2L 205099..205212 733..846 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 03:54:41 Download gff for BO01458.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 206001..206054 8..60 92   Minus
arm_2L 205272..205943 61..732 100 <- Minus
arm_2L 205099..205212 733..846 100 <- Minus

BO01458.complete Sequence

916 bp (916 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629505

> BO01458.complete
GAAGTTATCAGTCGACATGGACAAGTCAACGCGGCCTAAACGAAATCGTC
GACACAGCAGACGAGCCTGGCCACCAGAGGAGGAGTTGCATCCAGCATCC
CGAGCTACAAAGAGATTATTTACTCCCGACATTAAGAGGATGCTAAAGGA
CTGGTTAATTCGTCGCCGGGAGAATCCCTATCCTAGCAGGGAGGAGAAAA
AACAGCTTGCTGCAGAGACTGGACTTACTTACACTCAGATTTGCAATTGG
TTTGCAAACTGGCGAAGAAAGCTTAAAAACTCGGAGCGAGAGAAAGCCAA
GAAATCCTGGGGCCATCTGATCAAAAATTACAATCACAATGCAAGGGGTA
ATGTGGAACAATTTAGCATCTCGTCGGAGGATAGCATTTGGGAGGAGGAG
ATGCACTCATGTCCTGCGGAGGATGACGAAGGCGACGATAATGAAGAGTT
TTCCAGCCACAGTACTGGTAGCGATGGCAATGCCAATAATGAACCTTCAT
CCCCATACAAGCCGATATTGTTTGTAGGATCTGCAGGTCTGACCGAGCGG
ATATCAGCACAAACAGGGGGTAAGACCAAGTACAAGCATCAGATGATGGA
AAAGTATATGCGAGATAGTTCCACGGCAAAAACGACCAGTCAACAGGGTA
CGCAACTCAACAAGTGGCTGGAAAGTGCAGCAAAATTCACACCGGACAGG
AACAATTATCACATCGAGTGGAATATGACCAGGCAGAAAGCTAGCAGTAA
TAGCAGTTGTGGACAAGCGATCTTTACCACAGATGTGTCTGGGGCTGGTC
GTGGTGGACGCTGGATGCTTCATCATAAGGACGAACTGGAAGCAGCAGAG
GCCTTAGCCAACCTCGCCTTCAACTGCAGGCAGCGCTGGCACCATATCGC
AAGCTTTCTAGACCAT

BO01458.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG11617-RB 885 CG11617-PB 1..882 17..898 4410 100 Plus
CG11617-RA 885 CG11617-PA 1..882 17..898 4410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:19:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG11617-RB 1290 CG11617-RB 104..986 16..898 4415 100 Plus
CG11617-RA 1259 CG11617-RA 73..955 16..898 4415 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 205271..205946 733..58 3380 100 Minus
2L 23513712 2L 205047..205214 898..731 840 100 Minus
2L 23513712 2L 206001..206045 60..16 225 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:19:54 has no hits.

BO01458.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:07 Download gff for BO01458.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 1..885 17..902 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:53 Download gff for BO01458.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 73..960 16..903 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:30:20 Download gff for BO01458.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 74..955 17..900 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:08 Download gff for BO01458.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 73..960 16..903 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:15:59 Download gff for BO01458.complete
Subject Subject Range Query Range Percent Splice Strand
CG11617-RA 74..955 17..900 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:15:59 Download gff for BO01458.complete
Subject Subject Range Query Range Percent Splice Strand
2L 206001..206044 17..60 100   Minus
2L 205272..205943 61..732 100 <- Minus
2L 205045..205212 733..900 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:30:20 Download gff for BO01458.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 206001..206044 17..60 100   Minus
arm_2L 205272..205943 61..732 100 <- Minus
arm_2L 205045..205212 733..900 98 <- Minus

BO01458.pep Sequence

Translation from 16 to 916

> BO01458.pep
MDKSTRPKRNRRHSRRAWPPEEELHPASRATKRLFTPDIKRMLKDWLIRR
RENPYPSREEKKQLAAETGLTYTQICNWFANWRRKLKNSEREKAKKSWGH
LIKNYNHNARGNVEQFSISSEDSIWEEEMHSCPAEDDEGDDNEEFSSHST
GSDGNANNEPSSPYKPILFVGSAGLTERISAQTGGKTKYKHQMMEKYMRD
SSTAKTTSQQGTQLNKWLESAAKFTPDRNNYHIEWNMTRQKASSNSSCGQ
AIFTTDVSGAGRGGRWMLHHKDELEAAEALANLAFNCRQRWHHIASFLDH

BO01458.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG11617-PB 294 CG11617-PB 1..294 1..294 1596 100 Plus
CG11617-PA 294 CG11617-PA 1..294 1..294 1596 100 Plus