Clone BO01460 Report

Search the DGRC for BO01460

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:60
Vector:pDNR-Dual
Associated Gene/Transcripthkb-RA
Protein status:BO01460.pep: full length peptide match
Sequenced Size:925

Clone Sequence Records

BO01460.3prime Sequence

835 bp (710 high quality bases) assembled on 2005-11-30

> BO01460.3prime
ATGGTCTAGAAAGCTTGCGTAGCCATAAAGGTATGAGTACATGGGCACGA
AGATGGACGGGCCCAGCTGGCGCTCCTGCGGCATGTGCGTCTTCATGTGC
TTCTTTAAGTGGTCGCGTCGGCCAAACTTCTTTCCGCAGGCACTGCAAGG
ATACGGCCGCAGTCCGGTGTGGATTCGCTTGTGACGCGTCAGTTCCTCAT
TGCGGGTGAAGGTCTTGCCGCATGTGTTCACGTCGCACTTAAATGGGCGT
TCGCCGGTGTGGATGCGGATGTGGCCCTTCAGCTGGCCGTTGTTGGAGAA
GGCCACGTCGCAGTTGGGGCACTTGAACTTCTTCGGCCGCTGCTTGCGGC
TGTTGAGCGCCTTTAACTGTGCGTCCTCGGCCATCACGCGGGCGTACTCT
TGCTCCATCAGGCCCATAGTGAACGGGTCCATGCCGAAGCCCGGGACGGC
AGTGGGCGTGGAGGCAGCAGCGGCTGCTGCGGCGGCGGCAGCGTAGTAGA
GATCGCTGGCGGCCGACAGGAATGGAGCGTGCTGGTTTGGCGGAGCCAAG
GATGCGGTGGCGGCGGCGTGCGTGTCCAACGGCGACGACTGCGGGTGTGA
AAAGACGGGGTGCGGGGCGGCGTCCAGCAGCGGGGTGGAAGTGCGGGTGT
AGCTGCTGTGGTTCAGGGCCTCCTCGTAGCAGGACTTGCTGCTGTTGCTG
CTGCTTGACGCAGAGGAGGATGCGGAGGAGAAGTCTCCGTCGCAGTCGTG
GCCGAAACTGCTGCTGGCCAGCTCCGTCTTGATGGTAATCGCCTCCGGCT
CCTGCTTCACTGTCCTGGGTGCCGCCGAGGTCGCC

BO01460.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG9768-PA 894 hkb-RA 75..891 835..19 4085 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:15:55
Subject Length Description Subject Range Query Range Score Percent Strand
hkb-RA 1567 CG9768-RA 218..1034 835..19 4085 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:15:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4345848..4346429 254..835 2910 100 Plus
3R 32079331 3R 4345548..4345784 19..255 1185 100 Plus
Blast to na_te.dros performed 2015-02-13 16:15:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6862 766..641 169 61.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2334..2529 824..634 129 54.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2358..2448 725..634 115 59.8 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6868 766..641 108 58.7 Minus
gypsy3 6973 gypsy3 GYPSY3 6973bp 1935..2020 140..54 108 59.8 Minus

BO01460.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:49 Download gff for BO01460.3prime
Subject Subject Range Query Range Percent Splice Strand
hkb-PA 75..894 16..835 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:57 Download gff for BO01460.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9768-PA 75..894 16..835 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:57:34 Download gff for BO01460.3prime
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 218..1034 19..835 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:26:34 Download gff for BO01460.3prime
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 218..1034 19..835 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:26:34 Download gff for BO01460.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 4345849..4346429 255..835 100   Plus
3R 4345548..4345783 19..254 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:57:34 Download gff for BO01460.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 171571..172151 255..835 100   Plus
arm_3R 171270..171505 19..254 100 <- Plus

BO01460.5prime Sequence

793 bp (782 high quality bases) assembled on 2005-11-30

> BO01460.5prime
GAAGTTATCAGTCGACATGTCGACGATTAACCTGCATCCCCCGCAAACCT
ACTCGCGACTTTTCCGACCCTGGGATACTCAGCGCCAGGCGGCGACCTCG
GCGGCACCCAGGACAGTGAAGCAGGAGCCGGAGGCGATTACCATCAAGAC
GGAGCTGGCCAGCAGCAGTTTCGGCCACGACTGCGACGGAGACTTCTCCT
CCGCATCCTCCTCTGCGTCAAGCAGCAGCAACAGCAGCAAGTCCTGCTAC
GAGGAGGCCCTGAACCACAGCAGCTACACCCGCACTTCCACCCCGCTGCT
GGACGCCGCCCCGCACCCCGTCTTTTCACACCCGCAGTCGTCGCCGTTGG
ACACGCACGCCGCCGCCACCGCATCCTTGGCTCCGCCAAACCAGCACGCT
CCATTCCTGTCGGCCGCCAGCGATCTCTACTACGCTGCCGCCGCCGCAGC
AGCCGCTGCTGCCTCCACGCCCACTGCCGTCCCGGGCTTCGGCATGGACC
CGTTCACTATGGGCCTGATGGAGCAAGAGTACGCCCGCGTGATGGCCGAG
GACGCACAGTTAAAGGCGCTCAACAGCCGCAAGCAGCGGCCGAAGAAGTT
CAAGTGCCCCAACTGCGACGTGGCCTTCTCCAACAACGGCCAGCTGAAGG
GCCACATCCGCATCCACACCGGCGAACGCCCATTTAAGTGCGACGTGAAC
ACATGCGGCAAGACCTTCACCCGCAATGAGGAACTGACGCGTCACAAGCG
AATCCACACCGGACTGCGGCCGTATCCTTGCAGTGCCTGCGGA

BO01460.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG9768-PA 894 hkb-RA 1..777 17..793 3885 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
hkb-RA 1567 CG9768-RA 144..920 17..793 3885 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4345848..4346503 672..17 3280 100 Minus
3R 32079331 3R 4345662..4345784 793..671 615 100 Minus
Blast to na_te.dros performed 2015-02-10 15:38:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6862 160..285 169 61.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2301..2529 74..292 131 54.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2358..2448 201..292 115 59.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6868 160..285 108 58.7 Plus

BO01460.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:50 Download gff for BO01460.5prime
Subject Subject Range Query Range Percent Splice Strand
hkb-PA 1..776 17..792 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:28:59 Download gff for BO01460.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9768-PA 1..776 17..792 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 02:34:46 Download gff for BO01460.5prime
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 144..919 17..792 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:16:41 Download gff for BO01460.5prime
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 144..919 17..792 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:16:41 Download gff for BO01460.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 4345849..4346503 17..671 100   Minus
3R 4345663..4345783 672..792 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 02:34:46 Download gff for BO01460.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 171571..172225 17..671 100   Minus
arm_3R 171385..171505 672..792 100 <- Minus

BO01460.complete Sequence

925 bp (925 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629506

> BO01460.complete
GAAGTTATCAGTCGACATGTCGACGATTAACCTGCATCCCCCGCAAACCT
ACTCGCGACTTTTCCGACCCTGGGATACTCAGCGCCAGGCGGCGACCTCG
GCGGCACCCAGGACAGTGAAGCAGGAGCCGGAGGCGATTACCATCAAGAC
GGAGCTGGCCAGCAGCAGTTTCGGCCACGACTGCGACGGAGACTTCTCCT
CCGCATCCTCCTCTGCGTCAAGCAGCAGCAACAGCAGCAAGTCCTGCTAC
GAGGAGGCCCTGAACCACAGCAGCTACACCCGCACTTCCACCCCGCTGCT
GGACGCCGCCCCGCACCCCGTCTTTTCACACCCGCAGTCGTCGCCGTTGG
ACACGCACGCCGCCGCCACCGCATCCTTGGCTCCGCCAAACCAGCACGCT
CCATTCCTGTCGGCCGCCAGCGATCTCTACTACGCTGCCGCCGCCGCAGC
AGCCGCTGCTGCCTCCACGCCCACTGCCGTCCCGGGCTTCGGCATGGACC
CGTTCACTATGGGCCTGATGGAGCAAGAGTACGCCCGCGTGATGGCCGAG
GACGCACAGTTAAAGGCGCTCAACAGCCGCAAGCAGCGGCCGAAGAAGTT
CAAGTGCCCCAACTGCGACGTGGCCTTCTCCAACAACGGCCAGCTGAAGG
GCCACATCCGCATCCACACCGGCGAACGCCCATTTAAGTGCGACGTGAAC
ACATGCGGCAAGACCTTCACCCGCAATGAGGAACTGACGCGTCACAAGCG
AATCCACACCGGACTGCGGCCGTATCCTTGCAGTGCCTGCGGAAAGAAGT
TTGGCCGACGCGACCACTTAAAGAAGCACATGAAGACGCACATGCCGCAG
GAGCGCCAGCTGGGCCCGTCCATCTTCGTGCCCATGTACTCATACCTTTA
TGGCTACGCAAGCTTTCTAGACCAT

BO01460.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
hkb-RA 894 CG9768-PA 1..891 17..907 4455 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:53:01
Subject Length Description Subject Range Query Range Score Percent Strand
hkb-RA 1567 CG9768-RA 144..1034 17..907 4455 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:52:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4345848..4346503 672..17 3280 100 Minus
3R 32079331 3R 4345548..4345784 907..671 1185 100 Minus
Blast to na_te.dros performed 2014-11-28 00:52:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6862 160..285 169 61.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2301..2529 74..292 131 54.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2358..2448 201..292 115 59.8 Plus
gypsy3 6973 gypsy3 GYPSY3 6973bp 1935..2020 786..872 108 59.8 Plus

BO01460.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:09 Download gff for BO01460.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 1..894 17..910 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:55 Download gff for BO01460.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 148..1038 17..907 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:33:27 Download gff for BO01460.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 144..1034 17..909 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:09 Download gff for BO01460.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 148..1038 17..907 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:39:46 Download gff for BO01460.complete
Subject Subject Range Query Range Percent Splice Strand
hkb-RA 144..1034 17..909 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:39:46 Download gff for BO01460.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4345849..4346503 17..671 100   Minus
3R 4345545..4345783 672..909 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:33:27 Download gff for BO01460.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 171571..172225 17..671 100   Minus
arm_3R 171267..171505 672..909 99 <- Minus

BO01460.pep Sequence

Translation from 16 to 925

> BO01460.pep
MSTINLHPPQTYSRLFRPWDTQRQAATSAAPRTVKQEPEAITIKTELASS
SFGHDCDGDFSSASSSASSSSNSSKSCYEEALNHSSYTRTSTPLLDAAPH
PVFSHPQSSPLDTHAAATASLAPPNQHAPFLSAASDLYYAAAAAAAAAAS
TPTAVPGFGMDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKCPNC
DVAFSNNGQLKGHIRIHTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGL
RPYPCSACGKKFGRRDHLKKHMKTHMPQERQLGPSIFVPMYSYLYGYASF
LDH

BO01460.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
hkb-PA 297 CG9768-PA 1..297 1..297 1582 100 Plus
btd-PA 644 CG12653-PA 151..418 61..280 272 31.5 Plus
cbt-PC 347 CG4427-PC 31..264 40..275 270 31.2 Plus
cbt-PB 347 CG4427-PB 31..264 40..275 270 31.2 Plus
cbt-PA 428 CG4427-PA 112..345 40..275 270 31.2 Plus