Clone BO01462 Report

Search the DGRC for BO01462

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptBx-RA
Protein status:BO01462.pep:
Sequenced Size:973

Clone Sequence Records

BO01462.3prime Sequence

910 bp (764 high quality bases) assembled on 2005-11-30

> BO01462.3prime
ATGGTCTAGAAAGCTTGCGCTGGACGCGCCCAGTTGATTCTTCATATGGG
CAGCGGCGGCGGCGGCAGCAGCAGCAGCGGCAAACGGTGAGCCACCGCCG
GTCGGTGTCTGTGGGCCATTGTTGTTGTTATTGTGATCGCCAGGGGTGCG
CGGTCCGTTGACCATGCCCACGCCATTCACATTGCCGCCACCGGGTCCGC
CGCCCAGCAATCCACCAGCTGTATTCTGCGCCCCGGCCGCTCCCGTCGGT
GAGCCCTGGCCCAAGGAGGAGACGTGTCGCTTGAGCATCGGATGATTGGC
CATCGATGCGAAGACCAGGCGCTCCTCGTAGTCGTACTCGCAGAGTATCT
TGTTCTCGCACAGGTAGAAACGGTCGCCCACACAGAATCTGTGGTTACAC
TGCTGACAAGCGAAGCACTCCAAGTGATAGACATTGGTCCTTGCACGCAT
CACCATCTCGAAGGCTGGGATCACCTTGCTGCAGGCGGCGCAGTAGCCCG
TGTTGCCAAACAATCTCAAGTAGTCCCGCTTGCAGAGCATCAGGTTGCCC
TTGGTGTAGAGCGTGGAGCCCACCTCGCCCAGGCGGCAGTCGCAGCAGCC
GCACTTGAGGCAGTCCTCGTGCCACAGCATGTCCAGGGCGCGGAGGAGAT
AGCGGTCCTGGATGTGCTTGCCGCAGCCGGCGCACAATTGGCTGCCGTTG
TTGTTGTTATTGTTATTATTGTTGGCAGCGGCGGCGATGCTCTGGACATT
CCCGTTGCCATTTGTGCCCGCACCGGCACCGCCGGAGTTGACCACATTGA
CCACGTTCCCATTGCCATTGGGATTGGGCCCGTTGTCTGGCCACCGCTGT
TCATGCCGGCGTTGCTTTGCTGCGACTGCTGCTGCTGCTGCTGCTGTTGG
TGGGAGGAAA

BO01462.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG6500-PA 942 Bx-RA 196..939 762..19 3645 99.5 Minus
CG6500-PB 1155 Bx-RB 409..1152 762..19 3645 99.5 Minus
CG6500-PC 942 Bx-RC 196..939 762..19 3645 99.5 Minus
CG6500-PA 942 Bx-RA 47..121 910..836 350 98.6 Minus
CG6500-PB 1155 Bx-RB 260..334 910..836 350 98.6 Minus
CG6500-PC 942 Bx-RC 47..121 910..836 350 98.6 Minus
CG6500-PA 942 Bx-RA 122..187 836..771 330 100 Minus
CG6500-PB 1155 Bx-RB 335..400 836..771 330 100 Minus
CG6500-PC 942 Bx-RC 122..187 836..771 330 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:16:07
Subject Length Description Subject Range Query Range Score Percent Strand
Bx-RD 2494 CG44425-RD 809..1701 910..19 4320 99 Minus
Bx-RC 3413 CG44425-RC 645..1537 910..19 4320 99 Minus
Bx-RB 2051 CG44425-RB 366..1258 910..19 4320 99 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18566742..18567138 910..515 1860 98.5 Minus
X 23542271 X 18570561..18570933 391..19 1820 99.2 Minus
X 23542271 X 18567509..18567636 516..389 640 100 Minus
Blast to na_te.dros performed 2015-02-13 16:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 2731..2802 759..688 125 67.1 Minus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2627..2663 728..692 122 81.1 Minus
Stalker2 7672 Stalker2 STALKER2 7672bp 3144..3208 762..695 116 67.6 Minus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2649..2684 724..689 108 77.8 Minus

BO01462.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed on 2007-01-18 01:30:52 has no hits.
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:01 Download gff for BO01462.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6500-PA 50..942 15..907 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:57:36 Download gff for BO01462.3prime
Subject Subject Range Query Range Percent Splice Strand
Bx-RB 369..1261 15..907 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:27:09 Download gff for BO01462.3prime
Subject Subject Range Query Range Percent Splice Strand
Bx-RB 369..1261 15..907 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:27:09 Download gff for BO01462.3prime
Subject Subject Range Query Range Percent Splice Strand
X 18570564..18570936 15..388 98   Minus
X 18567511..18567636 389..514 100 -> Minus
X 18566745..18567138 515..907 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:57:36 Download gff for BO01462.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 18464597..18464969 15..388 98   Minus
arm_X 18461544..18461669 389..514 100 -> Minus
arm_X 18460778..18461171 515..907 98 -> Minus

BO01462.5prime Sequence

857 bp (737 high quality bases) assembled on 2005-11-30

> BO01462.5prime
GAAGTTATCAGTCGACATGATGACTATGGACATTACCAAAACCGAACCCG
GTCTCGTCGGGCTTTCCTCCAACCAACAGCAGCAGCAGCAGCAGCAGTCG
CAGCAAAGCAACGCCGGCATGAACAGCGGTGGCCAGAACAACGGGCCCAA
TCCCAATGGCAATGGGAACGTGGTCAATGTGGTCAACTCCGGCGGTGCCG
GTGGCGGCAACAATGGCAACGGGAATGTCCAGAGCATCGCCGCCGCTGCC
AACAATAATAACAATAACAACAACAACGGCAGCCAATTGTGCGCCGGCTG
CGGCAAGCACATCCAGGACCGCTATCTCCTCCGCGCCCTGGACATGCTGT
GGCACGAGGACTGCCTCAAGTGCGGCTGCTGCGACTGCCGCCTGGGCGAG
GTGGGCTCCACGCTCTACACCAAGGGCAACCTGATGCTCTGCAAGCGGGA
CTACTTGAGATTGTTTGGCAACACGGGCTACTGCGCCGCCTGCAGCAAGG
TGATCCCAGCCTTCGAGATGGTGATGCGTGCAAGGACCAATGTCTATCAC
TTGGAGTGCTTCGCTTGTCAGCAGTGTAACCACAGATTCTGTGTGGGCGA
CCGTTTCTACCTGTGCGAGAACAAGATACTCTGCGAGTACGACTACGAGG
AGCGCCTGGTCTTCGCATCGATGGCCAATCATCCGATGCTCAAGCGACAC
GTCTCCTCCTTGGGCCAGGGCTCACCGACGGGAGCGGCCGGGGCGCAGAA
TACAGCTGGTGGATTGCTGGGCGGCGGACCCGGTGGCGGCAATGTGAATG
GCGTGGGCATGGTCAACGGACCGCGCACCCCTGGCGATCACAATAACAAC
AACAATG

BO01462.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG6500-PA 942 Bx-RA 1..841 17..857 4130 99.6 Plus
CG6500-PB 1155 Bx-RB 214..1054 17..857 4130 99.6 Plus
CG6500-PC 942 Bx-RC 1..841 17..857 4130 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 21:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
Bx-RD 2494 CG44425-RD 763..1603 17..857 4160 99.6 Plus
Bx-RC 3413 CG44425-RC 599..1439 17..857 4160 99.6 Plus
Bx-RB 2051 CG44425-RB 320..1160 17..857 4160 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 21:53:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18566696..18567138 17..459 2215 100 Plus
X 23542271 X 18570561..18570835 583..857 1330 98.9 Plus
X 23542271 X 18567509..18567636 458..585 640 100 Plus
Blast to na_te.dros performed 2015-02-11 21:53:47
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 2731..2802 215..286 125 67.1 Plus
Stalker2 7672 Stalker2 STALKER2 7672bp 3132..3208 200..279 122 65 Plus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2627..2663 246..282 122 81.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2340..2430 184..277 112 59.6 Plus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2649..2684 250..285 108 77.8 Plus

BO01462.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed on 2007-01-18 01:30:52 has no hits.
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:02 Download gff for BO01462.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6500-PC 1..841 17..857 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:32:05 Download gff for BO01462.5prime
Subject Subject Range Query Range Percent Splice Strand
Bx-RB 320..1160 17..857 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:39:27 Download gff for BO01462.5prime
Subject Subject Range Query Range Percent Splice Strand
Bx-RB 320..1160 17..857 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 00:39:27 Download gff for BO01462.5prime
Subject Subject Range Query Range Percent Splice Strand
X 18570564..18570835 586..857 98   Plus
X 18567511..18567636 460..585 100 -> Plus
X 18566696..18567138 17..459 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:32:05 Download gff for BO01462.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 18464597..18464868 586..857 98   Plus
arm_X 18461544..18461669 460..585 100 -> Plus
arm_X 18460729..18461171 17..459 100 -> Plus

BO01462.complete Sequence

973 bp (973 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629507

> BO01462.complete
GAAGTTATCAGTCGACATGATGACTATGGACATTACCAAAACCGAACCCG
GTCTCGTCGGGCTTTCCTCCAACCAACAGCAGCAGCAGCAGCAGCAGTCG
CAGCAAAGCAACGCCGGCATGAACAGCGGTGGCCAGAACAACGGGCCCAA
TCCCAATGGCAATGGGAACGTGGTCAATGTGGTCAACTCCGGCGGTGCCG
GTGGCGGCAACAATGGCAACGGGAATGTCCAGAGCATCGCCGCCGCTGCC
AACAATAATAACAATAACAACAACAACGGCAGCCAATTGTGCGCCGGCTG
CGGCAAGCACATCCAGGACCGCTATCTCCTCCGCGCCCTGGACATGCTGT
GGCACGAGGACTGCCTCAAGTGCGGCTGCTGCGACTGCCGCCTGGGCGAG
GTGGGCTCCACGCTCTACACCAAGGGCAACCTGATGCTCTGCAAGCGGGA
CTACTTGAGATTGTTTGGCAACACGGGCTACTGCGCCGCCTGCAGCAAGG
TGATCCCAGCCTTCGAGATGGTGATGCGTGCAAGGACCAATGTCTATCAC
TTGGAGTGCTTCGCTTGTCAGCAGTGTAACCACAGATTCTGTGTGGGCGA
CCGTTTCTACCTGTGCGAGAACAAGATACTCTGCGAGTACGACTACGAGG
AGCGCCTGGTCTTCGCATCGATGGCCAATCATCCGATGCTCAAGCGACAC
GTCTCCTCCTTGGGCCAGGGCTCACCGACGGGAGCGGCCGGGGCGCAGAA
TACAGCTGGTGGATTGCTGGGCGGCGGACCCGGTGGCGGCAATGTGAATG
GCGTGGGCATGGTCAACGGACCGCGCACCCCTGGCGATCACAATAACAAC
AACAATGGCCCACAGACACCGACCGGCGGTGGCTCACCGTTTGCCGCTGC
TGCTGCTGCCGCCGCCGCCGCTGCCCATATGAAGAATCAACTGGGCGCGT
CCAGCGCAAGCTTTCTAGACCAT

BO01462.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:25:52
Subject Length Description Subject Range Query Range Score Percent Strand
Bx-RD 1275 CG44425-PD 1..939 17..955 4650 99.7 Plus
Bx-RC 942 CG44425-PC 1..939 17..955 4650 99.7 Plus
Bx-RB 1155 CG44425-PB 214..1152 17..955 4650 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:25:53
Subject Length Description Subject Range Query Range Score Percent Strand
Bx-RD 2494 CG44425-RD 763..1701 17..955 4650 99.7 Plus
Bx-RC 3413 CG44425-RC 599..1537 17..955 4650 99.7 Plus
Bx-RB 2051 CG44425-RB 320..1258 17..955 4650 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18566696..18567138 17..459 2215 100 Plus
X 23542271 X 18570561..18570933 583..955 1820 99.2 Plus
X 23542271 X 18567509..18567636 458..585 640 100 Plus
Blast to na_te.dros performed 2014-11-28 01:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 2731..2802 215..286 125 67.1 Plus
Stalker2 7672 Stalker2 STALKER2 7672bp 3132..3208 200..279 122 65 Plus
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2627..2663 246..282 122 81.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2340..2430 184..277 112 59.6 Plus

BO01462.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:11 Download gff for BO01462.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RC 1..942 17..959 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:58 Download gff for BO01462.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RC 592..1538 9..959 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:47:17 Download gff for BO01462.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RB 320..1258 17..957 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:11 Download gff for BO01462.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RC 592..1538 9..959 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:48:19 Download gff for BO01462.complete
Subject Subject Range Query Range Percent Splice Strand
Bx-RB 320..1258 17..957 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 02:48:19 Download gff for BO01462.complete
Subject Subject Range Query Range Percent Splice Strand
X 18570564..18570933 586..957 98   Plus
X 18567511..18567636 460..585 100 -> Plus
X 18566696..18567138 17..459 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:47:17 Download gff for BO01462.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18464597..18464966 586..957 98   Plus
arm_X 18461544..18461669 460..585 100 -> Plus
arm_X 18460729..18461171 17..459 100 -> Plus

BO01462.pep Sequence

Translation from 16 to 973

> BO01462.pep
MMTMDITKTEPGLVGLSSNQQQQQQQQSQQSNAGMNSGGQNNGPNPNGNG
NVVNVVNSGGAGGGNNGNGNVQSIAAAANNNNNNNNNGSQLCAGCGKHIQ
DRYLLRALDMLWHEDCLKCGCCDCRLGEVGSTLYTKGNLMLCKRDYLRLF
GNTGYCAACSKVIPAFEMVMRARTNVYHLECFACQQCNHRFCVGDRFYLC
ENKILCEYDYEERLVFASMANHPMLKRHVSSLGQGSPTGAAGAQNTAGGL
LGGGPGGGNVNGVGMVNGPRTPGDHNNNNNGPQTPTGGGSPFAAAAAAAA
AAAHMKNQLGASSASFLDH

BO01462.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
Bx-PC 313 CG44425-PC 1..313 1..313 1709 100 Plus
Bx-PA 313 CG44425-PA 1..313 1..313 1709 100 Plus
Bx-PF 383 CG44425-PF 71..383 1..313 1709 100 Plus
Bx-PB 384 CG44425-PB 72..384 1..313 1709 100 Plus
Bx-PD 424 CG44425-PD 1..313 1..313 1709 100 Plus