Clone BO01464 Report

Search the DGRC for BO01464

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG4854-RA
Protein status:BO01464.pep: full length peptide match
Sequenced Size:991

Clone Sequence Records

BO01464.3prime Sequence

925 bp (796 high quality bases) assembled on 2005-11-30

> BO01464.3prime
ATGGTCTAGAAAGCTTGCTTTTACCTCTTTCGTCCTTTTGTGTGACTTTT
CGTGGCTGTTTTTGTGGTGCAGCTGGGAGAAGGACTTCTGGCAGTACTGG
CAGCTAAATGGTCGTTCACCGGTATGGGTTTTCAGATGAACCCGGAGGAC
GTTGGAGTAGCCAAAGGACCTGCTGCAGAACTCGCATTTGTACGGTCGTT
CGTTGGTGTGGATCCTCTGATGCTTAATGCGAGTGGAGGGATCGGCGAAC
CTGGAGTCGCAATAGTCACATTTGTAGGGACGATTACCGGTGTGGGTGTT
CATGTGCCTCGCCAACTGCGGAGTCTGGCGAAAACGTTTGTGACAGATTT
CGCATTCGTGTGGTTTCTTCGCGCTGTGGACTTTCATGTGGTTGGTCAAC
TTTACGCGCTCTGAGTAGACATTGTTGCAAATGTTGCAGGTAAAGGAAGC
AGCCTGTCCGGAGTCCTCGTCTTCAAAAGTTACCGGTTTGGGACTAAGTG
AATAGACAGATTCCTCTGGAGCGGAGATGGCAGGCTCTATGCTGACCAAT
TCATCGGCACTACAGGCCACATCCTCGCTGCTCTCCAGCGTTACATCGTA
TGAGTCTAGGTACTCGTACTCCAACTCGCTGTCGCTACCGGTAGCCTCAT
TCTTGGACAGGTCTCTTGATTCAGTTTTCTTCTTCGTCTCCTGCTCATCG
TGAACAATCTCTATGTTTATCTCCTGCAGCTTCTGCTCCTTCAGATCCTT
CTCCGTCTGCTGGCAAAGGGATCTGAGTTTGAGGGCAGCTCTGAGCAGCA
GGGCGCAGCTGGTGCAGATGCGATTGGGCCAGTCGGGACTCTCACTCAAT
TTCACTCCTGTGCAGCGTTTGATTTTATCTGGAAAATCGGGCTCCGTGGG
CATGAGAGACTCATCCTTAAGCTGC

BO01464.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG4854-PA 960 CG4854-RA 51..953 925..23 4440 99.6 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 06:02:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG4854-RA 1220 CG4854-RA 148..1054 925..19 4475 99.6 Minus
CG4936-RA 1824 CG4936-RA 1311..1457 328..182 225 77.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 06:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20028339..20028838 849..350 2500 100 Minus
3R 32079331 3R 20029198..20029395 216..19 975 99.5 Minus
3R 32079331 3R 20028904..20029039 349..214 680 100 Minus
3R 32079331 3R 20028205..20028276 925..854 345 98.6 Minus
Blast to na_te.dros performed on 2015-02-13 06:02:35 has no hits.

BO01464.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:55 Download gff for BO01464.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4854-PA 51..960 16..925 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:08 Download gff for BO01464.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4854-PA 51..960 16..925 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 17:50:13 Download gff for BO01464.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 150..1056 19..925 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:12:09 Download gff for BO01464.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 148..1054 19..925 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 08:12:09 Download gff for BO01464.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 20029200..20029395 19..214 99   Minus
3R 20028904..20029038 215..349 100 -> Minus
3R 20028344..20028838 350..844 100 -> Minus
3R 20028205..20028284 845..925 93 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 17:50:13 Download gff for BO01464.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15854922..15855117 19..214 99   Minus
arm_3R 15854626..15854760 215..349 100 -> Minus
arm_3R 15854066..15854560 350..844 100 -> Minus
arm_3R 15853927..15854006 845..925 93 -> Minus

BO01464.5prime Sequence

799 bp (772 high quality bases) assembled on 2005-11-30

> BO01464.5prime
GAAGTTATCAGTCGACATGCATACCAACGTGGATAGCAGGGACCTTAAGT
GTCGCATCTGCTTGGTGCAGCCTAAGGATGAGTCTCTCATGCCCACGGAG
CCCGATTTTCCAGATAAAATCAAACGCTGCACAGGAGTTGAATTGAGTGA
GAGTCCCGACTGGCCCAATCGCATCTGCACCAGCTGCGCCCTGCTGCTCA
GAGCTGCCCTCAAACTCAGATCCCTTTGCCAGCAGACGGAGAAGGATCTG
AAGGAGCAGAAGCTGCAGGAGATAAACATAGAGATTGTTCACGATGAGCA
GGAGACGAAGAAGAAAACTGAATCAAGAGACCTGTCCAAGAATGAGGCTA
CCGGTAGCGACAGCGAGTTGGAGTACGAGTACCTAGACTCATACGATGTA
ACGCTGGAGAGCAGCGAGGATGTGGCCTGTAGTGCCGATGAATTGGTCAG
CATAGAGCCTGCCATCTCCGCTCCAGAGGAATCTGTCTATTCACTTAGTC
CCAAACCGGTAACTTTTGAAGACGAGGACTCCGGACAGGCTGCTTCCTTT
ACCTGCAACATTTGCAACAATGTCTACTCAGAGCGCGTAAAGTTGACCAA
CCACATGAAAGTCCACAGCGCGAAGAAACCACACGAATGCGAAATCTGTC
ACAAACGTTTTCGCCAGACTCCGCAGTTGGCGAGGCACATGAACACCCAC
ACCGGTAATCGTCCCTACAAATGTGACTATTGCGACTCCAGGTTCGCCGA
TCCCTCCACTCGCATTAAGCATCAGAGGATCCACACCAACGAACGACCG

BO01464.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG4854-PA 960 CG4854-RA 1..783 17..799 3915 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG4854-RA 1220 CG4854-RA 98..880 17..799 3915 100 Plus
CG4936-RA 1824 CG4936-RA 1311..1445 664..798 210 77.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:22:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20028339..20028838 143..642 2500 100 Plus
3R 32079331 3R 20028904..20029039 643..778 680 100 Plus
3R 32079331 3R 20028155..20028280 17..142 630 100 Plus
Blast to na_te.dros performed on 2015-02-11 04:22:03 has no hits.

BO01464.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:57 Download gff for BO01464.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4854-PA 1..783 17..799 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:10 Download gff for BO01464.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4854-PA 1..783 17..799 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 05:01:28 Download gff for BO01464.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 90..882 6..799 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:04:14 Download gff for BO01464.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 88..880 6..799 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:04:14 Download gff for BO01464.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 20029200..20029221 778..799 100   Plus
3R 20028904..20029038 643..777 100 -> Plus
3R 20028339..20028838 143..642 100 -> Plus
3R 20028145..20028280 6..142 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 05:01:28 Download gff for BO01464.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15854922..15854943 778..799 100   Plus
arm_3R 15854626..15854760 643..777 100 -> Plus
arm_3R 15854061..15854560 143..642 100 -> Plus
arm_3R 15853867..15854002 6..142 97 -> Plus

BO01464.complete Sequence

991 bp (991 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629508

> BO01464.complete
GAAGTTATCAGTCGACATGCATACCAACGTGGATAGCAGGGACCTTAAGT
GTCGCATCTGCTTGGTGCAGCCTAAGGATGAGTCTCTCATGCCCACGGAG
CCCGATTTTCCAGATAAAATCAAACGCTGCACAGGAGTTGAATTGAGTGA
GAGTCCCGACTGGCCCAATCGCATCTGCACCAGCTGCGCCCTGCTGCTCA
GAGCTGCCCTCAAACTCAGATCCCTTTGCCAGCAGACGGAGAAGGATCTG
AAGGAGCAGAAGCTGCAGGAGATAAACATAGAGATTGTTCACGATGAGCA
GGAGACGAAGAAGAAAACTGAATCAAGAGACCTGTCCAAGAATGAGGCTA
CCGGTAGCGACAGCGAGTTGGAGTACGAGTACCTAGACTCATACGATGTA
ACGCTGGAGAGCAGCGAGGATGTGGCCTGTAGTGCCGATGAATTGGTCAG
CATAGAGCCTGCCATCTCCGCTCCAGAGGAATCTGTCTATTCACTTAGTC
CCAAACCGGTAACTTTTGAAGACGAGGACTCCGGACAGGCTGCTTCCTTT
ACCTGCAACATTTGCAACAATGTCTACTCAGAGCGCGTAAAGTTGACCAA
CCACATGAAAGTCCACAGCGCGAAGAAACCACACGAATGCGAAATCTGTC
ACAAACGTTTTCGCCAGACTCCGCAGTTGGCGAGGCACATGAACACCCAC
ACCGGTAATCGTCCCTACAAATGTGACTATTGCGACTCCAGGTTCGCCGA
TCCCTCCACTCGCATTAAGCATCAGAGGATCCACACCAACGAACGACCGT
ACAAATGCGAGTTCTGCAGCAGGTCCTTTGGCTACTCCAACGTCCTCCGG
GTTCATCTGAAAACCCATACCGGTGAACGACCATTTAGCTGCCAGTACTG
CCAGAAGTCCTTCTCCCAGCTGCACCACAAAAACAGCCACGAAAAGTCAC
ACAAAAGGACGAAAGAGGTAAAAGCAAGCTTTCTAGACCAT

BO01464.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG4854-RA 960 CG4854-PA 1..957 17..973 4770 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG4854-RA 1220 CG4854-RA 98..1054 17..973 4770 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20028339..20028838 143..642 2500 100 Plus
3R 32079331 3R 20029198..20029395 776..973 975 99.5 Plus
3R 32079331 3R 20028904..20029039 643..778 680 100 Plus
3R 32079331 3R 20028155..20028280 17..142 630 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:23:26 has no hits.

BO01464.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:12 Download gff for BO01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 1..960 17..976 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:17:00 Download gff for BO01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 90..1056 6..973 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:53:10 Download gff for BO01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 100..1052 17..969 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:12 Download gff for BO01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 90..1056 6..973 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:17:28 Download gff for BO01464.complete
Subject Subject Range Query Range Percent Splice Strand
CG4854-RA 98..1050 17..969 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:17:28 Download gff for BO01464.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20029200..20029391 778..969 100   Plus
3R 20028904..20029038 643..777 100 -> Plus
3R 20028339..20028838 143..642 100 -> Plus
3R 20028155..20028280 17..142 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:53:10 Download gff for BO01464.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15854922..15855113 778..969 100   Plus
arm_3R 15854626..15854760 643..777 100 -> Plus
arm_3R 15854061..15854560 143..642 100 -> Plus
arm_3R 15853877..15854002 17..142 100 -> Plus

BO01464.pep Sequence

Translation from 16 to 991

> BO01464.pep
MHTNVDSRDLKCRICLVQPKDESLMPTEPDFPDKIKRCTGVELSESPDWP
NRICTSCALLLRAALKLRSLCQQTEKDLKEQKLQEINIEIVHDEQETKKK
TESRDLSKNEATGSDSELEYEYLDSYDVTLESSEDVACSADELVSIEPAI
SAPEESVYSLSPKPVTFEDEDSGQAASFTCNICNNVYSERVKLTNHMKVH
SAKKPHECEICHKRFRQTPQLARHMNTHTGNRPYKCDYCDSRFADPSTRI
KHQRIHTNERPYKCEFCSRSFGYSNVLRVHLKTHTGERPFSCQYCQKSFS
QLHHKNSHEKSHKRTKEVKASFLDH

BO01464.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG4854-PA 319 CG4854-PA 1..319 1..319 1720 100 Plus
trem-PA 439 CG4413-PA 173..408 93..314 471 41.2 Plus
CG4424-PA 345 CG4424-PA 11..326 12..317 460 32.7 Plus
CG4936-PA 521 CG4936-PA 360..496 178..314 460 56.2 Plus
CG14711-PA 377 CG14711-PA 7..365 12..315 455 30.9 Plus
trem-PA 439 CG4413-PA 1..354 1..316 218 21.1 Plus