Clone BO01466 Report

Search the DGRC for BO01466

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:66
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO01466.pep:
Sequenced Size:997

Clone Sequence Records

BO01466.3prime Sequence

861 bp (754 high quality bases) assembled on 2005-11-30

> BO01466.3prime
ATGGTCTAGAAAGCTTGCCCTTTCTGGTGGCTTGATCGATAGGCATCTGG
CCGTGGTGCAGTCCCTGTAGAGGATGTCGAAGTCCTTGCAGCAGAGCAAC
TTGCAGCGATTGACGCCCGGCTGGATGGCGCCCAAGCCGCGTAATATGCG
CACCTGTTCCACATTGCAGACGAGCGGTACGATGTCAAGGCGCTTTAGTT
TGGTATAAACCGTATGCAGACCGCCGACCAAGTGCTTCAGGAAGAGCTCG
AAGGCCTGCGGCAGGCAGAGCATCGTTTCGTTGCTAATTATGAATGCGGC
GACCTTCTGACCCCGGTACTCCACCAGCTTGCACTCATTGGCACTGGGAT
CCGAGGTGGAGATCGGCGGCGGTGAGTTGTACGACCTTGGAGGCACATGG
TGATGGGCGGCGGCCATCAGTTCCAAGGGGGAGGCATGGTGCATCATCTG
CAGGGAGTTGAGGAGCCCCAGCGAATGGGGCGGCAGTCCATGGGGCATTC
TGGGCGGTAGGCCCGTCGGCAGTCCGTTGCCCGATGGCATTCCATGTGGC
GGGGGGCTGAGCTGATGGTGTTGCTGCTGCTGCTGTTGCTGCTGCTGTTG
TTGCTGCTGTTGCTGCATCTGCTGCATCATGGAGTGGTTGAGGGAGCTCA
CCGGACTGACGGCACTGGGATGGCGACTTGGTGAACTGGCCGGTGAGCAA
CTGGATCCTCGTCCTGTGTGCGAGCTCCGTCCATTTGGACGATCCTCGTT
GGCTCCACGCGAACTGTTGCTACCGTCGCGTCCATTGTGCTGCTGCTGTT
GCTGCTGGGCTGCTGCGGCTGCCGCTGCTGCGGCTGCCTGCTGCTGCTGC
TGGTGATGCAT

BO01466.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG4952-PE 3246 dac-RE 121..962 861..20 4185 99.8 Minus
CG4952-PD 3225 dac-RD 121..962 861..20 4185 99.8 Minus
CG4952-PB 3246 dac-RB 121..962 861..20 4185 99.8 Minus
CG4952-PF 3219 dac-RF 121..962 861..20 4185 99.8 Minus
CG4952-PG 3192 dac-RG 121..936 861..46 4055 99.8 Minus
CG4952-PA 3219 dac-RA 121..935 861..47 4050 99.8 Minus
CG4952-PC 3198 dac-RC 121..935 861..47 4050 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 12:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
dac-RF 4955 CG4952-RF 748..1589 861..20 4195 99.9 Minus
dac-RB 4982 CG4952-RB 748..1589 861..20 4195 99.9 Minus
dac-RD 4961 CG4952-RD 748..1589 861..20 4195 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 12:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16483808..16484622 47..861 4060 99.9 Plus
Blast to na_te.dros performed on 2015-02-13 12:24:43 has no hits.

BO01466.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:30:59 Download gff for BO01466.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4952-PF 121..962 20..861 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:15 Download gff for BO01466.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4952-PD 121..968 14..861 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:35:22 Download gff for BO01466.3prime
Subject Subject Range Query Range Percent Splice Strand
dac-RD 748..1595 14..861 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:35:26 Download gff for BO01466.3prime
Subject Subject Range Query Range Percent Splice Strand
dac-RD 748..1595 14..861 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:35:26 Download gff for BO01466.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 16483808..16484622 47..861 99   Plus
2L 16481520..16481551 15..46 93 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:35:22 Download gff for BO01466.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16483808..16484622 47..861 99   Plus
arm_2L 16481520..16481551 15..46 93 <- Plus

BO01466.5prime Sequence

840 bp (737 high quality bases) assembled on 2005-11-30

> BO01466.5prime
GAAGTTATCAGTCGACATGGATTCTGTGACAAGTGAACAGAGTGAAAATA
ACAACAATAAAGCGGGCGCAATAAATAACAATATTAATAGTGGTATTGAA
AGAGCCGCGGGCAATATGAACACCACCGCCATGTTGATGCATCACCAGCA
GCAGCAGCAGGCAGCCGCAGCAGCGGCAGCCGCAGCAGCCCAGCAGCAAC
AGCAGCAGCACAATGGACGCGACGGTAGCAACAGTTCGCGTGGAGCCAAC
GAGGATCGTCCAAATGGACGGAGCTCGCACACAGGACGAGGATCCAGTTG
CTCACCGGCCAGTTCACCAAGTCGCCATCCCAGTGCCGTCAGTCCGGTGA
GCTCCCTCAACCACTCCATGATGCAGCAGATGCAGCAACAGCAGCAACAA
CAGCAGCAGCAACAGCAGCAGCAGCAACACCATCAGCTCAGCCCCCCGCC
ACATGGAATGCCATCGGGCAACGGACTGCCGACGGGCCTACCGCCCAGAA
TGCCCCATGGACTGCCGCCCCATTCGCTGGGGCTCCTCAACTCCCTGCAG
ATGATGCACCATGCCTCCCCCTTGGAACTGATGGCCGCCGCCCATCACCA
TGTGCCTCCAAGGTCGTACAACTCACCGCCGCCGATCTCCACCTCGGATC
CCAGTGCCAATGAGTGCAAGCTGGTGGAGTACCGGGGTCAGAAGGTCGCC
GCATTCATAATTAGCAACGAAACGATGCTCTGCCTGCCGCAGGCCTTCGA
GCTCTTCCTGAAGCACTTGGTCGGCGGTCTGCATACGGTTTATACCAAAC
TAAAGCGCCTTGACATCGTACCGCTCGTCTGCAATGTGGA

BO01466.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG4952-PE 3246 dac-RE 1..824 17..840 4095 99.8 Plus
CG4952-PD 3225 dac-RD 1..824 17..840 4095 99.8 Plus
CG4952-PA 3219 dac-RA 1..824 17..840 4095 99.8 Plus
CG4952-PB 3246 dac-RB 1..824 17..840 4095 99.8 Plus
CG4952-PF 3219 dac-RF 1..824 17..840 4095 99.8 Plus
CG4952-PG 3192 dac-RG 1..824 17..840 4095 99.8 Plus
CG4952-PC 3198 dac-RC 1..824 17..840 4095 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 21:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
dac-RC 4934 CG4952-RC 628..1451 17..840 4105 99.9 Plus
dac-RG 4928 CG4952-RG 628..1451 17..840 4105 99.9 Plus
dac-RF 4955 CG4952-RF 628..1451 17..840 4105 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 21:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16483919..16484742 840..17 4105 99.9 Minus
Blast to na_te.dros performed on 2015-02-11 21:54:59 has no hits.

BO01466.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:00 Download gff for BO01466.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4952-PA 1..823 17..839 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:16 Download gff for BO01466.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4952-PC 1..823 17..839 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:32:10 Download gff for BO01466.5prime
Subject Subject Range Query Range Percent Splice Strand
dac-RF 625..1450 10..839 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:42:57 Download gff for BO01466.5prime
Subject Subject Range Query Range Percent Splice Strand
dac-RF 625..1450 10..839 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 00:42:57 Download gff for BO01466.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 16483920..16484745 10..839 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:32:10 Download gff for BO01466.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16483920..16484745 10..839 99   Minus

BO01466.complete Sequence

997 bp (997 high quality bases) assembled on 2005-06-23

> BO01466.complete
GAAGTTATCAGTCGACATGGATTCTGTGACAAGTGAACAGAGTGAAAATA
ACAACAATAAAGCGGGCGCAATAAATAACAATATTAATAGTGGTATTGAA
AGAGCCGCGGGCAATATGAACACCACCGCCATGTTGATGCATCACCAGCA
GCAGCAGCAGGCAGCCGCAGCAGCGGCAGCCGCAGCAGCCCAGCAGCAAC
AGCAGCAGCACAATGGACGCGACGGTAGCAACAGTTCGCGTGGAGCCAAC
GAGGATCGTCCAAATGGACGGAGCTCGCACACAGGACGAGGATCCAGTTG
CTCACCGGCCAGTTCACCAAGTCGCCATCCCAGTGCCGTCAGTCCGGTGA
GCTCCCTCAACCACTCCATGATGCAGCAGATGCAGCAACAGCAGCAACAA
CAGCAGCAGCAACAGCAGCAGCAGCAACACCATCAGCTCAGCCCCCCGCC
ACATGGAATGCCATCGGGCAACGGACTGCCGACGGGCCTACCGCCCAGAA
TGCCCCATGGACTGCCGCCCCATTCGCTGGGGCTCCTCAACTCCCTGCAG
ATGATGCACCATGCCTCCCCCTTGGAACTGATGGCCGCCGCCCATCACCA
TGTGCCTCCAAGGTCGTACAACTCACCGCCGCCGATCTCCACCTCGGATC
CCAGTGCCAATGAGTGCAAGCTGGTGGAGTACCGGGGTCAGAAGGTCGCC
GCATTCATAATTAGCAACGAAACGATGCTCTGCCTGCCGCAGGCCTTCGA
GCTCTTCCTGAAGCACTTGGTCGGCGGTCTGCATACGGTTTATACCAAAC
TAAAGCGCCTTGACATCGTACCGCTCGTCTGCAATGTGGAACAGGTGCGC
ATATTACGCGGCTTGGGCGCCATCCAGCCGGGCGTCAATCGCTGCAAGTT
GCTCTGCTGCAAGGACTTCGACATCCTCTACAGGGACTGCACCACGGCCA
GATGCCTATCGATCAAGCCACCAGAAAGGGCAAGCTTTCTAGACCAT

BO01466.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
dac-RF 3219 CG4952-PF 1..962 17..978 4795 99.9 Plus
dac-RB 3246 CG4952-PB 1..962 17..978 4795 99.9 Plus
dac-RD 3225 CG4952-PD 1..962 17..978 4795 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:24:16
Subject Length Description Subject Range Query Range Score Percent Strand
dac-RF 4955 CG4952-RF 628..1589 17..978 4795 99.9 Plus
dac-RB 4982 CG4952-RB 628..1589 17..978 4795 99.9 Plus
dac-RD 4961 CG4952-RD 628..1589 17..978 4795 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16483808..16484742 951..17 4660 99.9 Minus
Blast to na_te.dros performed on 2014-11-27 15:24:14 has no hits.

BO01466.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:54 Download gff for BO01466.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RB 1..967 17..986 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:36 Download gff for BO01466.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RB 611..1580 10..986 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:40:34 Download gff for BO01466.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RD 628..1592 17..981 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:54 Download gff for BO01466.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RB 611..1580 10..986 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:06:50 Download gff for BO01466.complete
Subject Subject Range Query Range Percent Splice Strand
dac-RD 628..1592 17..981 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:06:50 Download gff for BO01466.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16483808..16484742 17..951 99   Minus
2L 16481522..16481551 952..981 93 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:40:34 Download gff for BO01466.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16483808..16484742 17..951 99   Minus
arm_2L 16481522..16481551 952..981 93 <- Minus

BO01466.pep Sequence

Translation from 16 to 997

> BO01466.pep
MDSVTSEQSENNNNKAGAINNNINSGIERAAGNMNTTAMLMHHQQQQQAA
AAAAAAAAQQQQQQHNGRDGSNSSRGANEDRPNGRSSHTGRGSSCSPASS
PSRHPSAVSPVSSLNHSMMQQMQQQQQQQQQQQQQQQHHQLSPPPHGMPS
GNGLPTGLPPRMPHGLPPHSLGLLNSLQMMHHASPLELMAAAHHHVPPRS
YNSPPPISTSDPSANECKLVEYRGQKVAAFIISNETMLCLPQAFELFLKH
LVGGLHTVYTKLKRLDIVPLVCNVEQVRILRGLGAIQPGVNRCKLLCCKD
FDILYRDCTTARCLSIKPPERASFLDH

BO01466.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
dac-PF 1072 CG4952-PF 1..321 1..321 1700 100 Plus
dac-PB 1081 CG4952-PB 1..323 1..323 1696 99.4 Plus
dac-PD 1074 CG4952-PD 1..320 1..320 1695 100 Plus
dac-PC 1065 CG4952-PC 1..321 1..321 1658 97.8 Plus
dac-PG 1063 CG4952-PG 1..319 1..321 1654 98.1 Plus