Clone BO01468 Report

Search the DGRC for BO01468

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG13123-RA
Protein status:BO01468.pep: full length peptide match
Sequenced Size:1003

Clone Sequence Records

BO01468.3prime Sequence

844 bp (778 high quality bases) assembled on 2005-11-30

> BO01468.3prime
ATGGTCTAGAAAGCTTGCTGAGCGCGGATTATCCCGATCCTGACTGGCTG
GCCTGTAATCCAGCAGTGCCACCTGTGCGGGCAGCTGAACTCCATGAATT
TTCTTTAAGTGAGCCCTCAGATTGCTACTGGTACTAAAGTTGTTGGAGCA
GACAACGCACTGGTGATGCGGATGCTTCTGCCGAATATGCTCATTGAGAT
CGCGAACCTTGGCGAAGGCGGTGGTGCAGTACTTGCAGACGTGCGAATTG
CGCACGTGGGTTTTCAGATATTGAGGCGAGGCATAAGCCAGTGGGCAGTA
CTGGCACTTGTAGATGGCCTGGCTGCCACTGGGCTCCACGTCCAGCAGGC
GATTGGCCTCGTTGTACTCGTCCAGGTTGTAGTGTTTCAGTTCGACGGCA
GCATAGTCCACGGTGCGCATCTCGTATGCTGGGGATTCCAGTTGCTCCAG
CTGAGAGTCGGATAGATCCAGTCGTGGTTGGGCTGTGGTGGCAGGTAAAA
ACTCGGAGACAATCAGCGAATCTTGGTTGGCCAGCCTTTGAGAGGGTTTC
GTACAGCTATCCGTCCTTCTCCTCGTTTGTCTTGTTTCTGTAGGACGATC
GGGGTCTAAAACCACATAATCCAGTGGTATCCTCCTGAATTCCTCCAGTA
TCTCGAATTCATCACTAGCCTGGTTTTCGGGCTCTTCCTCCGTTGCGTCC
ATCTTAACTTGGCACATTTCTACCTCCGCCTCGTTGTAGAGCTGCAGTAG
CTGCTGATTGGCGAACGTTAGCTTCCTGAAGAAGGCGTACTGCTGCAGGC
AATCTTCCAAGCAATCATTACAGATCATGGGCAGCTCCTCAGTA

BO01468.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG13123-PA 972 CG13123-RA 144..969 844..19 4130 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:50:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG13123-RC 1087 CG13123-RC 238..1063 844..19 4130 100 Minus
CG13123-RB 996 CG13123-RB 147..972 844..19 4130 100 Minus
CG13123-RA 1094 CG13123-RA 245..1070 844..19 4130 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9791985..9792810 19..844 4130 100 Plus
Blast to na_te.dros performed on 2015-02-12 05:50:29 has no hits.

BO01468.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:03 Download gff for BO01468.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13123-PA 145..972 15..843 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:20 Download gff for BO01468.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13123-PA 145..972 15..843 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:18:20 Download gff for BO01468.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 246..1073 15..843 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:57:32 Download gff for BO01468.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 246..1073 15..843 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:57:32 Download gff for BO01468.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 9791982..9792809 15..843 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:18:20 Download gff for BO01468.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9791982..9792809 15..843 99   Plus

BO01468.5prime Sequence

869 bp (737 high quality bases) assembled on 2005-11-30

> BO01468.5prime
GAAGTTATCAGTCGACATGGACCTGCGTAAACTGTGCCGCATTTGCTTCG
TGGACAGCGCTTCGGTGGATATACGGGAGCACAGGAGCGGTGGCAGTTCG
GATCAGACAGTCCTCCAGCTGATAGAAGCCATGTTCGGCTGGAACATAGC
ACTTAATCTTACTGAGGAGCTGCCCATGATCTGTAATGATTGCTTGGAAG
ATTGCCTGCAGCAGTACGCCTTCTTCAGGAAGCTAACGTTCGCCAATCAG
CAGCTACTGCAGCTCTACAACGAGGCGGAGGTAGAAATGTGCCAAGTTAA
GATGGACGCAACGGAGGAAGAGCCCGAAAACCAGGCTAGTGATGAATTCG
AGATACTGGAGGAATTCAGGAGGATACCACTGGATTATGTGGTTTTAGAC
CCCGATCGTCCTACAGAAACAAGACAAACGAGGAGAAGGACGGATAGCTG
TACGAAACCCTCTCAAAGGCTGGCCAACCAAGATTCGCTGATTGTCTCCG
AGTTTTTACCTGCCACCACAGCCCAACCACGACTGGATCTATCCGACTCT
CAGCTGGAGCAACTGGAATCCCCAGCATACGAGATGCGCACCGTGGACTA
TGCTGCCGTCGAACTGAAACACTACAACCTGGACGAGTACAACGAGGCCA
ATCGCCTGCTGGACGTGGAGCCCAGTGGCAGCCAGGCCATCTACAAGTGC
CAGTACTGCCCACTGGCTTATGCCTCGCCTCAATATCTGAAAACCCACGT
GCGCAATTCGCACGTCTGCAAGTACTGCACCACCGCCTTCGCCAAGGTTC
GCGATCTCAATGAGCATATTCGGCAGAAGCATCCGCATCACCAGTGCGTT
GTCTGCTCCNACAACTTTA

BO01468.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13123-PA 972 CG13123-RA 1..853 17..869 4246 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 18:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13123-RA 1094 CG13123-RA 101..954 16..869 4259 99.9 Plus
CG13123-RC 1087 CG13123-RC 101..947 16..869 4144 99.1 Plus
CG13123-RB 996 CG13123-RB 45..856 58..869 4049 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 18:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9792101..9792828 869..142 3629 99.9 Minus
2L 23513712 2L 9792881..9793007 142..16 635 100 Minus
Blast to na_te.dros performed on 2015-02-04 18:54:24 has no hits.

BO01468.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:04 Download gff for BO01468.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13123-PA 1..852 17..868 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:22 Download gff for BO01468.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13123-PA 1..852 17..868 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:12:15 Download gff for BO01468.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 101..953 16..868 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:27:25 Download gff for BO01468.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 101..953 16..868 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:27:25 Download gff for BO01468.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 9792881..9793007 16..142 100   Minus
2L 9792102..9792827 143..868 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:12:15 Download gff for BO01468.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9792881..9793007 16..142 100   Minus
arm_2L 9792102..9792827 143..868 99 <- Minus

BO01468.complete Sequence

1003 bp (1003 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629509

> BO01468.complete
GAAGTTATCAGTCGACATGGACCTGCGTAAACTGTGCCGCATTTGCTTCG
TGGACAGCGCTTCGGTGGATATACGGGAGCACAGGAGCGGTGGCAGTTCG
GATCAGACAGTCCTCCAGCTGATAGAAGCCATGTTCGGCTGGAACATAGC
ACTTAATCTTACTGAGGAGCTGCCCATGATCTGTAATGATTGCTTGGAAG
ATTGCCTGCAGCAGTACGCCTTCTTCAGGAAGCTAACGTTCGCCAATCAG
CAGCTACTGCAGCTCTACAACGAGGCGGAGGTAGAAATGTGCCAAGTTAA
GATGGACGCAACGGAGGAAGAGCCCGAAAACCAGGCTAGTGATGAATTCG
AGATACTGGAGGAATTCAGGAGGATACCACTGGATTATGTGGTTTTAGAC
CCCGATCGTCCTACAGAAACAAGACAAACGAGGAGAAGGACGGATAGCTG
TACGAAACCCTCTCAAAGGCTGGCCAACCAAGATTCGCTGATTGTCTCCG
AGTTTTTACCTGCCACCACAGCCCAACCACGACTGGATCTATCCGACTCT
CAGCTGGAGCAACTGGAATCCCCAGCATACGAGATGCGCACCGTGGACTA
TGCTGCCGTCGAACTGAAACACTACAACCTGGACGAGTACAACGAGGCCA
ATCGCCTGCTGGACGTGGAGCCCAGTGGCAGCCAGGCCATCTACAAGTGC
CAGTACTGCCCACTGGCTTATGCCTCGCCTCAATATCTGAAAACCCACGT
GCGCAATTCGCACGTCTGCAAGTACTGCACCACCGCCTTCGCCAAGGTTC
GCGATCTCAATGAGCATATTCGGCAGAAGCATCCGCATCACCAGTGCGTT
GTCTGCTCCAACAACTTTAGTACCAGTAGCAATCTGAGGGCTCACTTAAA
GAAAATTCATGGAGTTCAGCTGCCCGCACAGGTGGCACTGCTGGATTACA
GGCCAGCCAGTCAGGATCGGGATAATCCGCGCTCAGCAAGCTTTCTAGAC
CAT

BO01468.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:52:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG13123-RA 972 CG13123-PA 1..969 17..985 4845 100 Plus
CG13123-RC 813 CG13123-PC 1..810 176..985 4050 100 Plus
CG13123-RB 813 CG13123-PB 1..810 176..985 4050 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13123-RA 1094 CG13123-RA 101..1070 16..985 4850 100 Plus
CG13123-RC 1087 CG13123-RC 101..1063 16..985 4710 99.3 Plus
CG13123-RB 996 CG13123-RB 45..972 58..985 4640 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9791985..9792828 985..142 4220 100 Minus
2L 23513712 2L 9792881..9793007 142..16 635 100 Minus
Blast to na_te.dros performed on 2014-11-26 16:52:15 has no hits.

BO01468.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:55 Download gff for BO01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 1..972 17..989 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:37 Download gff for BO01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 91..1063 16..989 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:11:53 Download gff for BO01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 102..1070 17..987 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:55 Download gff for BO01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 91..1063 16..989 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:29:24 Download gff for BO01468.complete
Subject Subject Range Query Range Percent Splice Strand
CG13123-RA 102..1070 17..987 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:29:24 Download gff for BO01468.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9792881..9793006 17..142 100   Minus
2L 9791983..9792827 143..987 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:11:53 Download gff for BO01468.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9792881..9793006 17..142 100   Minus
arm_2L 9791983..9792827 143..987 99 <- Minus

BO01468.pep Sequence

Translation from 16 to 1003

> BO01468.pep
MDLRKLCRICFVDSASVDIREHRSGGSSDQTVLQLIEAMFGWNIALNLTE
ELPMICNDCLEDCLQQYAFFRKLTFANQQLLQLYNEAEVEMCQVKMDATE
EEPENQASDEFEILEEFRRIPLDYVVLDPDRPTETRQTRRRTDSCTKPSQ
RLANQDSLIVSEFLPATTAQPRLDLSDSQLEQLESPAYEMRTVDYAAVEL
KHYNLDEYNEANRLLDVEPSGSQAIYKCQYCPLAYASPQYLKTHVRNSHV
CKYCTTAFAKVRDLNEHIRQKHPHHQCVVCSNNFSTSSNLRAHLKKIHGV
QLPAQVALLDYRPASQDRDNPRSASFLDH

BO01468.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG13123-PA 323 CG13123-PA 1..323 1..323 1703 100 Plus
CG13123-PC 270 CG13123-PC 1..270 54..323 1430 100 Plus
CG13123-PB 270 CG13123-PB 1..270 54..323 1430 100 Plus