Clone BO01470 Report

Search the DGRC for BO01470

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptCG11398-RA
Protein status:BO01470.pep: full length peptide match
Sequenced Size:1021

Clone Sequence Records

BO01470.3prime Sequence

862 bp (744 high quality bases) assembled on 2005-11-30

> BO01470.3prime
ATGGTCTAGAAAGCTTGCATTGAATAACTCGCTTTCGTTTTCGTCCTCTG
CAAATATGGCAGTCATCTTGCCGGTGTTCGAAAATTGTGAATTCTCCAGG
TATCCTGCGCTGTCGAGGGCGTCAACTCCTTTCAGCCATTGGAGCTCCTC
GTCCTGGGACTCGTCTATTGCGCTTCTCTGGCTTCGATTCTTCGCAGCAA
GGGCCGGACTAAACTGCGGTTTTTGGCGGACAATCGGATCGTTGTGGTGG
CCACTGGCCAAGCCATGGCGTATCAACTGATTGCGCCGCATATAATCTGC
TCCGCAGACGGAGCATATATAGGCCTTACAGATACTATGGACGAAGAGAT
GAACATCCCTGTTTTCGGGCCGTCCGAAGAGCTTTCCACAGATCGGACAG
CCGTAGCTCTTCGCGGAGCCATGGGACGCCAAGTGCTTTCTATAATTTAC
AGGATGGCTGAAGCGGGCACTGCAGGTGTCGCAAACGAGGTTCCGCTCAT
TCTGGTGGACCGTCTTCACATGCTGATCACACTCCCGCCTCTGCTGGAAA
CGCTTCTTGCAGCCCGGTTCTGGACAGGAGTGCAGGTACACCTTCCGATG
AACGTTCTTCAGGTGACACTCCCTATTGCTGCGCTGCACAAAGCGCGCCG
GACACTCGGGACACGGATAGTTCCGCACGTCGTTGTGGGCATTCATGTGA
TCCACAAGGGCGTTGTGCTTTTGGAAGACCCTTCCACACGCGTCGCAGGC
ATGCTCCGACGCGGGCGTTTGCTGTCCACCCTGGTATCGGTGTGTGGGCC
GATGGGGCGCCAACTCCTCCCTGGTGAGGAATAGCGCTGGACAGCGTCTG
CAGACGAAGGAC

BO01470.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG11398-PA 990 CG11398-RA 144..987 862..19 4170 99.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG11398-RD 3018 CG11398-RD 222..1065 862..19 4190 99.8 Minus
CG11398-RA 1487 CG11398-RA 222..1065 862..19 4190 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1213942..1214785 19..862 4190 99.8 Plus
Blast to na_te.dros performed on 2015-02-12 16:04:40 has no hits.

BO01470.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:06 Download gff for BO01470.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11398-PA 144..990 16..862 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:26 Download gff for BO01470.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11398-PA 144..990 16..862 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:24:24 Download gff for BO01470.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 222..1069 15..862 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:40:20 Download gff for BO01470.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 222..1069 15..862 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:40:20 Download gff for BO01470.3prime
Subject Subject Range Query Range Percent Splice Strand
X 1213938..1214785 15..862 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:24:24 Download gff for BO01470.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 1107971..1108818 15..862 99   Plus

BO01470.5prime Sequence

865 bp (827 high quality bases) assembled on 2005-11-30

> BO01470.5prime
GAAGTTATCAGTCGACATGACTGAAGTACAATATAAAGAGGCCGAGATCT
TGGCTCTACTACCACATACATATGAGGATGAGGAGCTGTCCTTAAACACA
GAAGAGCTACAGTTCGAGGAACTCAATGAGAGAAGCCAGCACCAGCAAGG
CGGATCTCCGTCCTTCGTCTGCAGACGCTGTCCAGCGCTATTCCTCACCA
GGGAGGAGTTGGCCGCCCATCGGCCCACACACCGATACCAGGGTGGACAG
CAAACGCCCGCGTCGGAGCATGCCTGCGACGCGTGTGGAAGGGTCTTCCA
AAAGCACAACGCCCTTGTGGATCACATGAATGCCCACAACGACGTGCGGA
ACTATCCGTGTCCCGAGTGTCCGGCGCGCTTTGTGCAGCGCAGCAATAGG
GAGTGTCACCTGAAGAACGTTCATCGGAAGGTGTACCTGCACTCCTGTCC
AGAACCGGGCTGCAAGAAGCGTTTCCAGCAGAGGCGGGAGTGTGATCAGC
ATGTGAAGACGGTCCACCAGAATGAGCGGAACCTCGTTTGCGACACCTGC
AGTGCCCGCTTCAGCCATCCTGTAAATTATAGAAAGCACTTGGCGTCCCA
TGGCTCCGCGAAGAGCTACGGCTGTCCGATCTGTGGAAAGCTCTTCGGAC
GGCCCGAAAACAGGGATGTTCATCTCTTCGTCCATAGTATCTGTAAGGCC
TATATATGCTCCGTCTGCGGAGCAGATTATATGCGGCGCAATCAGTTGAT
ACGCCATGGCTTGGCCAGTGGCCACCACAACGATCCGATTGTCCGCCAAA
AACCGCAGTTTAGTCCGGCCCCTTGCTGCGAAGAATCGAAGCCAGAGAAG
CGCAATAGACGAGTC

BO01470.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG11398-PA 990 CG11398-RA 1..805 17..821 4025 100 Plus
CG11398-PA 990 CG11398-RA 803..848 820..865 230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:42:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG11398-RD 3018 CG11398-RD 79..926 17..865 4220 99.9 Plus
CG11398-RA 1487 CG11398-RA 79..926 17..865 4220 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1214081..1214793 865..152 3520 99.9 Minus
X 23542271 X 1214942..1215078 153..17 685 100 Minus
Blast to na_te.dros performed on 2015-02-11 15:42:06 has no hits.

BO01470.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:07 Download gff for BO01470.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11398-PA 1..848 17..865 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:28 Download gff for BO01470.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11398-PA 1..848 17..865 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:48:08 Download gff for BO01470.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 73..926 8..865 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:13:14 Download gff for BO01470.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 73..926 8..865 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:13:14 Download gff for BO01470.5prime
Subject Subject Range Query Range Percent Splice Strand
X 1214943..1215084 8..152 97   Minus
X 1214081..1214792 153..865 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:48:08 Download gff for BO01470.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 1108976..1109117 8..152 97   Minus
arm_X 1108114..1108825 153..865 99 <- Minus

BO01470.complete Sequence

1021 bp (1021 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629510

> BO01470.complete
GAAGTTATCAGTCGACATGACTGAAGTACAATATAAAGAGGCCGAGATCT
TGGCTCTACTACCACATACATATGAGGATGAGGAGCTGTCCTTAAACACA
GAAGAGCTACAGTTCGAGGAACTCAATGAGAGAAGCCAGCACCAGCAAGG
CGGATCTCCGTCCTTCGTCTGCAGACGCTGTCCAGCGCTATTCCTCACCA
GGGAGGAGTTGGCCGCCCATCGGCCCACACACCGATACCAGGGTGGACAG
CAAACGCCCGCGTCGGAGCATGCCTGCGACGCGTGTGGAAGGGTCTTCCA
AAAGCACAACGCCCTTGTGGATCACATGAATGCCCACAACGACGTGCGGA
ACTATCCGTGTCCCGAGTGTCCGGCGCGCTTTGTGCAGCGCAGCAATAGG
GAGTGTCACCTGAAGAACGTTCATCGGAAGGTGTACCTGCACTCCTGTCC
AGAACCGGGCTGCAAGAAGCGTTTCCAGCAGAGGCGGGAGTGTGATCAGC
ATGTGAAGACGGTCCACCAGAATGAGCGGAACCTCGTTTGCGACACCTGC
AGTGCCCGCTTCAGCCATCCTGTAAATTATAGAAAGCACTTGGCGTCCCA
TGGCTCCGCGAAGAGCTACGGCTGTCCGATCTGTGGAAAGCTCTTCGGAC
GGCCCGAAAACAGGGATGTTCATCTCTTCGTCCATAGTATCTGTAAGGCC
TATATATGCTCCGTCTGCGGAGCAGATTATATGCGGCGCAATCAGTTGAT
ACGCCATGGCTTGGCCAGTGGCCACCACAACGATCCGATTGTCCGCCAAA
AACCGCAGTTTAGTCCGGCCCTTGCTGCGAAGAATCGAAGCCAGAGAAGC
GCAATAGACGAGTCCCAGGACGAGGAGCTCCAATGGCTGAAAGGAGTTGA
CGCCCTCGACAGCGCAGGATACCTGGAGAATTCACAATTTTCGAACACCG
GCAAGATGACTGCCATATTTGCAGAGGACGAAAACGAAAGCGAGTTATTC
AATGCAAGCTTTCTAGACCAT

BO01470.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:06:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG11398-RD 990 CG11398-PD 1..987 17..1003 4935 100 Plus
CG11398-RA 990 CG11398-PA 1..987 17..1003 4935 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG11398-RD 3018 CG11398-RD 79..1065 17..1003 4935 100 Plus
CG11398-RA 1487 CG11398-RA 79..1065 17..1003 4935 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:06:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1213942..1214793 1003..152 4260 100 Minus
X 23542271 X 1214942..1215078 153..17 685 100 Minus
Blast to na_te.dros performed on 2014-11-27 14:06:13 has no hits.

BO01470.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:56 Download gff for BO01470.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 1..990 17..1006 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:39 Download gff for BO01470.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 48..1044 8..1007 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:40 Download gff for BO01470.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 79..1065 17..1005 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:56 Download gff for BO01470.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 48..1044 8..1007 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:03:20 Download gff for BO01470.complete
Subject Subject Range Query Range Percent Splice Strand
CG11398-RA 79..1065 17..1005 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:03:20 Download gff for BO01470.complete
Subject Subject Range Query Range Percent Splice Strand
X 1214943..1215078 17..152 100   Minus
X 1213939..1214792 153..1005 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:40 Download gff for BO01470.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1108976..1109111 17..152 100   Minus
arm_X 1107972..1108825 153..1005 99 <- Minus

BO01470.pep Sequence

Translation from 16 to 1021

> BO01470.pep
MTEVQYKEAEILALLPHTYEDEELSLNTEELQFEELNERSQHQQGGSPSF
VCRRCPALFLTREELAAHRPTHRYQGGQQTPASEHACDACGRVFQKHNAL
VDHMNAHNDVRNYPCPECPARFVQRSNRECHLKNVHRKVYLHSCPEPGCK
KRFQQRRECDQHVKTVHQNERNLVCDTCSARFSHPVNYRKHLASHGSAKS
YGCPICGKLFGRPENRDVHLFVHSICKAYICSVCGADYMRRNQLIRHGLA
SGHHNDPIVRQKPQFSPALAAKNRSQRSAIDESQDEELQWLKGVDALDSA
GYLENSQFSNTGKMTAIFAEDENESELFNASFLDH

BO01470.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG11398-PD 329 CG11398-PD 1..329 1..329 1798 100 Plus
CG11398-PA 329 CG11398-PA 1..329 1..329 1798 100 Plus
Meics-PB 571 CG8474-PB 223..418 45..247 274 28.6 Plus
Meics-PA 583 CG8474-PA 235..430 45..247 274 28.6 Plus
CG15269-PA 587 CG15269-PA 297..485 49..247 269 29.9 Plus
Meics-PB 571 CG8474-PB 284..483 46..256 265 28.9 Plus
Meics-PA 583 CG8474-PA 296..495 46..256 265 28.9 Plus
Meics-PB 571 CG8474-PB 340..563 46..247 186 23.3 Plus
Meics-PA 583 CG8474-PA 352..575 46..247 186 23.3 Plus
Meics-PB 571 CG8474-PB 410..571 33..199 156 30.1 Plus
Meics-PA 583 CG8474-PA 422..583 33..199 156 30.1 Plus