Clone BO01472 Report

Search the DGRC for BO01472

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:72
Vector:pDNR-Dual
Associated Gene/Transcripth-RA
Protein status:BO01472.pep: full length peptide match
Sequenced Size:1045

Clone Sequence Records

BO01472.3prime Sequence

836 bp (821 high quality bases) assembled on 2005-11-30

> BO01472.3prime
ATGGTCTAGAAAGCTTGCCCAGGGCCGCCAGGGCTGCTCCTCCTCCTTGA
TCTGCTTCTTGATCACCAGCGACAGGGGCTGCTGCTCCATTGGCACGCGC
TGGATGACCGATGGCTTGATGTCCATGGGCTCGTAGCTAGAGTTGGCCGG
ACTGGGCGGGGCGTAGCTACAGCTGCTGCTGCTTCCGGGCGCCGACTCGT
ATCCGGCGGAGGAGTGCGAGCTGGCGGATCCGGTGCTGGCTGTACGCTGG
GGCATGCTGACCAACATGGGTTGCTGTTGTGCTGCTGCTGCGGCCGCTGC
TGCTGCTGCGACGGCGAGTTGCTGCTGCTGCTGTTGGTGCTGCAGCAACT
GTTGCTGCTGCTGCTGGGGCAGGCTCTGGGGCAACACGAGGGCAATGCTA
CCGTTGGGCAGCTTGGTGGGGATCACCTGCATGCCATTGGGCAGAAAGTA
ACCGCTGGCCGTCTGCTGGATACCAAAGAGGTAGGGTGCCGCTGCTCCCT
GCTGGCTATCCTGCTCCGGCGAGCTGGGCGGCGAGGGCAGCATCTGGGCG
TGGATGGACTGCTGTTGCTGCTGGCGCTGCTGCTGGTGCAGCTCTGTCTT
AACGCCATTGATGCAGTTGCTCAGGTGCTGTAGCAGGCGACGACGCTGGG
CGGGCTCGATGCCGGGAAAGCGGCTAACCTCGTTCACACAGTCGGCGAAT
CCGGCCTTGAATTTGTTCACAATCTTGGGATCGGCGGCCTGCTGCATGGC
TGCCTGCTGGCGCTGCAGCTCCTGCAGATGCTTTACTGTCTTCTCCAGAA
TGTCGGCCTTTTCCAATTTGGAGTGGCGAGCCGGGT

BO01472.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG6494-PA 1014 h-RA 194..1011 836..19 4090 100 Minus
CG6494-PB 1014 h-RB 194..1011 836..19 4090 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 23:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
h-RB 2335 CG6494-RB 685..1502 836..19 4090 100 Minus
h-RA 2139 CG6494-RA 489..1306 836..19 4090 100 Minus
dpn-RA 2036 CG8704-RA 503..585 836..754 220 84.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 23:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8677605..8678420 834..19 4080 100 Minus
2R 25286936 2R 8230422..8230502 754..834 210 84 Plus
Blast to na_te.dros performed 2015-02-12 23:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2825..2930 382..271 186 66.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..7079 649..281 168 55.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6868 648..556 167 67 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2313..2665 636..298 162 55.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6825 648..560 154 67.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6847 648..559 150 66.7 Minus
roo 9092 roo DM_ROO 9092bp 1051..1152 657..560 147 65.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1516..1583 632..559 140 70.3 Minus
roo 9092 roo DM_ROO 9092bp 1053..1129 638..559 140 67.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2313..2386 630..560 138 71.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2311..2372 621..559 132 71.9 Minus
roo 9092 roo DM_ROO 9092bp 1060..1141 637..559 131 67.1 Minus
roo 9092 roo DM_ROO 9092bp 1068..1109 599..558 129 78.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2382..2473 648..560 128 63 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6733..6771 597..560 120 82.1 Minus
roo 9092 roo DM_ROO 9092bp 1081..1120 597..559 116 80 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 7392..7532 593..452 111 58.6 Minus
roo 9092 roo DM_ROO 9092bp 1055..1087 591..559 111 81.8 Minus

BO01472.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:10 Download gff for BO01472.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6494-PB 194..1014 18..836 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:32 Download gff for BO01472.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6494-PB 194..1014 18..836 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 20:21:52 Download gff for BO01472.3prime
Subject Subject Range Query Range Percent Splice Strand
h-RA 489..1306 19..836 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:25:48 Download gff for BO01472.3prime
Subject Subject Range Query Range Percent Splice Strand
h-RA 489..1306 19..836 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:25:48 Download gff for BO01472.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 8677603..8678420 19..836 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 20:21:52 Download gff for BO01472.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8670703..8671520 19..836 99   Minus

BO01472.5prime Sequence

840 bp (810 high quality bases) assembled on 2005-11-30

> BO01472.5prime
GAAGTTATCAGTCGACATGGTTACCGGCGTAACAGCAGCCAACATGACCA
ACGTTCTGGGCACCGCCGTTGTGCCGGCCCAGCTCAAGGAGACGCCGCTC
AAAAGTGACCGTCGGTCGAACAAGCCCATCATGGAGAAACGCCGACGTGC
CCGTATTAACAACTGTCTCAATGAACTCAAGACTCTGATTCTGGATGCCA
CCAAAAAAGACCCGGCTCGCCACTCCAAATTGGAAAAGGCCGACATTCTG
GAGAAGACAGTAAAGCATCTGCAGGAGCTGCAGCGCCAGCAGGCAGCCAT
GCAGCAGGCCGCCGATCCCAAGATTGTGAACAAATTCAAGGCCGGATTCG
CCGACTGTGTGAACGAGGTTAGCCGCTTTCCCGGCATCGAGCCCGCCCAG
CGTCGTCGCCTGCTACAGCACCTGAGCAACTGCATCAATGGCGTTAAGAC
AGAGCTGCACCAGCAGCAGCGCCAGCAGCAACAGCAGTCCATCCACGCCC
AGATGCTGCCCTCGCCGCCCAGCTCGCCGGAGCAGGATAGCCAGCAGGGA
GCAGCGGCACCCTACCTCTTTGGTATCCAGCAGACGGCCAGCGGTTACTT
TCTGCCCAATGGCATGCAGGTGATCCCCACCAAGCTGCCCAACGGTAGCA
TTGCCCTCGTGTTGCCCCAGAGCCTGCCCCAGCAGCAGCAGCAACAGTTG
CTGCAGCACCAACAGCAGCAGCAGCAACTCGCCGTCGCAGCAGCAGCAGC
GGCCGCAGCAGCAGCACAACAGCAACCCATGTTGGTCAGCATGCCCCAGC
GTACAGCCAGCACCGGATCCCGCAGCTCGCACTCCTCCGC

BO01472.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG6494-PA 1014 h-RA 1..824 17..840 4070 99.7 Plus
CG6494-PB 1014 h-RB 1..824 17..840 4070 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
h-RB 2335 CG6494-RB 488..1315 13..840 4095 99.6 Plus
h-RA 2139 CG6494-RA 292..1119 13..840 4095 99.6 Plus
dpn-RA 2036 CG8704-RA 412..585 119..292 360 80.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 16:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8677605..8678233 212..840 3115 99.7 Plus
3L 28110227 3L 8676246..8676348 13..115 500 99 Plus
3L 28110227 3L 8677371..8677467 115..211 485 100 Plus
2R 25286936 2R 8230422..8230502 292..212 210 84 Minus
Blast to na_te.dros performed 2015-02-13 16:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2825..2930 664..775 186 66.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..7079 397..765 168 55.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6868 398..490 167 67 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2313..2665 410..748 162 55.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6825 398..486 154 67.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6847 398..487 150 66.7 Plus
roo 9092 roo DM_ROO 9092bp 1051..1152 389..486 147 65.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1516..1583 414..487 140 70.3 Plus
roo 9092 roo DM_ROO 9092bp 1053..1129 408..487 140 67.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2313..2386 416..486 138 71.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2311..2372 425..487 132 71.9 Plus
roo 9092 roo DM_ROO 9092bp 1060..1141 409..487 131 67.1 Plus
roo 9092 roo DM_ROO 9092bp 1068..1109 447..488 129 78.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2382..2473 398..486 128 63 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6733..6771 449..486 120 82.1 Plus
roo 9092 roo DM_ROO 9092bp 1081..1120 449..487 116 80 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 7392..7532 453..594 111 58.6 Plus
roo 9092 roo DM_ROO 9092bp 1055..1087 455..487 111 81.8 Plus

BO01472.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:11 Download gff for BO01472.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6494-PB 1..824 17..840 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:34 Download gff for BO01472.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6494-PB 1..824 17..840 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:57:38 Download gff for BO01472.5prime
Subject Subject Range Query Range Percent Splice Strand
h-RA 284..1119 6..840 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 18:27:27 Download gff for BO01472.5prime
Subject Subject Range Query Range Percent Splice Strand
h-RA 284..1119 6..840 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 18:27:27 Download gff for BO01472.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 8677605..8678233 212..840 99   Plus
3L 8677372..8677467 116..211 100 -> Plus
3L 8676238..8676348 6..115 96 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:57:38 Download gff for BO01472.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8670705..8671333 212..840 99   Plus
arm_3L 8670472..8670567 116..211 100 -> Plus
arm_3L 8669338..8669448 6..115 96 -> Plus

BO01472.complete Sequence

1045 bp (1045 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629511

> BO01472.complete
GAAGTTATCAGTCGACATGGTTACCGGCGTAACAGCAGCCAACATGACCA
ACGTTCTGGGCACCGCCGTTGTGCCGGCCCAGCTCAAGGAGACGCCGCTC
AAAAGTGACCGTCGGTCGAACAAGCCCATCATGGAGAAACGCCGACGTGC
CCGTATTAACAACTGTCTCAATGAACTCAAGACTCTGATTCTGGATGCCA
CCAAAAAAGACCCGGCTCGCCACTCCAAATTGGAAAAGGCCGACATTCTG
GAGAAGACAGTAAAGCATCTGCAGGAGCTGCAGCGCCAGCAGGCAGCCAT
GCAGCAGGCCGCCGATCCCAAGATTGTGAACAAATTCAAGGCCGGATTCG
CCGACTGTGTGAACGAGGTTAGCCGCTTTCCCGGCATCGAGCCCGCCCAG
CGTCGTCGCCTGCTACAGCACCTGAGCAACTGCATCAATGGCGTTAAGAC
AGAGCTGCACCAGCAGCAGCGCCAGCAGCAACAGCAGTCCATCCACGCCC
AGATGCTGCCCTCGCCGCCCAGCTCGCCGGAGCAGGATAGCCAGCAGGGA
GCAGCGGCACCCTACCTCTTTGGTATCCAGCAGACGGCCAGCGGTTACTT
TCTGCCCAATGGCATGCAGGTGATCCCCACCAAGCTGCCCAACGGTAGCA
TTGCCCTCGTGTTGCCCCAGAGCCTGCCCCAGCAGCAGCAGCAACAGTTG
CTGCAGCACCAACAGCAGCAGCAGCAACTCGCCGTCGCAGCAGCAGCAGC
GGCCGCAGCAGCAGCACAACAGCAACCCATGTTGGTCAGCATGCCCCAGC
GTACAGCCAGCACCGGATCCGCCAGCTCGCACTCCTCCGCCGGATACGAG
TCGGCGCCCGGAAGCAGCAGCAGCTGTAGCTACGCCCCGCCCAGTCCGGC
CAACTCTAGCTACGAGCCCATGGACATCAAGCCATCGGTCATCCAGCGCG
TGCCAATGGAGCAGCAGCCCCTGTCGCTGGTGATCAAGAAGCAGATCAAG
GAGGAGGAGCAGCCCTGGCGGCCCTGGGCAAGCTTTCTAGACCAT

BO01472.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
h-RB 1014 CG6494-PB 1..1011 17..1027 5055 100 Plus
h-RA 1014 CG6494-PA 1..1011 17..1027 5055 100 Plus
dpn-RA 1308 CG8704-PA 130..303 119..292 360 80.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
h-RB 2335 CG6494-RB 488..1502 13..1027 5060 99.9 Plus
h-RA 2139 CG6494-RA 292..1306 13..1027 5060 99.9 Plus
dpn-RA 2036 CG8704-RA 412..585 119..292 360 80.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:13:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8677605..8678420 212..1027 4080 100 Plus
3L 28110227 3L 8676246..8676348 13..115 500 99 Plus
3L 28110227 3L 8677371..8677467 115..211 485 100 Plus
2R 25286936 2R 8230422..8230502 292..212 210 84 Minus
Blast to na_te.dros performed 2014-11-27 15:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2825..2930 664..775 186 66.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6721..7079 397..765 168 55.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6868 398..490 167 67 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2313..2665 410..748 162 55.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6825 398..486 154 67.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6847 398..487 150 66.7 Plus
roo 9092 roo DM_ROO 9092bp 1051..1152 389..486 147 65.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1516..1583 414..487 140 70.3 Plus
roo 9092 roo DM_ROO 9092bp 1053..1129 408..487 140 67.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2313..2386 416..486 138 71.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2311..2372 425..487 132 71.9 Plus
roo 9092 roo DM_ROO 9092bp 1060..1141 409..487 131 67.1 Plus
roo 9092 roo DM_ROO 9092bp 1068..1109 447..488 129 78.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2382..2473 398..486 128 63 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6733..6771 449..486 120 82.1 Plus
roo 9092 roo DM_ROO 9092bp 1081..1120 449..487 116 80 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 7392..7532 453..594 111 58.6 Plus
roo 9092 roo DM_ROO 9092bp 1055..1087 455..487 111 81.8 Plus

BO01472.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:58 Download gff for BO01472.complete
Subject Subject Range Query Range Percent Splice Strand
h-RB 1..1014 17..1028 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:40 Download gff for BO01472.complete
Subject Subject Range Query Range Percent Splice Strand
h-RB 480..1502 6..1027 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:45:00 Download gff for BO01472.complete
Subject Subject Range Query Range Percent Splice Strand
h-RA 296..1306 17..1029 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:58 Download gff for BO01472.complete
Subject Subject Range Query Range Percent Splice Strand
h-RB 480..1502 6..1027 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:02:55 Download gff for BO01472.complete
Subject Subject Range Query Range Percent Splice Strand
h-RA 296..1306 17..1029 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:02:55 Download gff for BO01472.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8677605..8678420 212..1029 99   Plus
3L 8677372..8677467 116..211 100 -> Plus
3L 8676250..8676348 17..115 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:45:00 Download gff for BO01472.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8670705..8671520 212..1029 99   Plus
arm_3L 8670472..8670567 116..211 100 -> Plus
arm_3L 8669350..8669448 17..115 100 -> Plus

BO01472.pep Sequence

Translation from 16 to 1045

> BO01472.pep
MVTGVTAANMTNVLGTAVVPAQLKETPLKSDRRSNKPIMEKRRRARINNC
LNELKTLILDATKKDPARHSKLEKADILEKTVKHLQELQRQQAAMQQAAD
PKIVNKFKAGFADCVNEVSRFPGIEPAQRRRLLQHLSNCINGVKTELHQQ
QRQQQQQSIHAQMLPSPPSSPEQDSQQGAAAPYLFGIQQTASGYFLPNGM
QVIPTKLPNGSIALVLPQSLPQQQQQQLLQHQQQQQQLAVAAAAAAAAAA
QQQPMLVSMPQRTASTGSASSHSSAGYESAPGSSSSCSYAPPSPANSSYE
PMDIKPSVIQRVPMEQQPLSLVIKKQIKEEEQPWRPWASFLDH

BO01472.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
h-PB 337 CG6494-PB 1..337 1..337 1712 100 Plus
h-PA 337 CG6494-PA 1..337 1..337 1712 100 Plus
dpn-PA 435 CG8704-PA 41..231 32..219 411 47 Plus
Side-PA 507 CG10446-PA 19..388 4..290 282 27.8 Plus
E(spl)mbeta-HLH-PA 195 CG14548-PA 14..179 32..182 219 32.5 Plus