Clone BO01477 Report

Search the DGRC for BO01477

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptDip3-RA
Protein status:BO01477.pep:
Sequenced Size:1078

Clone Sequence Records

BO01477.3prime Sequence

878 bp (773 high quality bases) assembled on 2005-11-30

> BO01477.3prime
ATGGTCTAGAAAGCTTGCGCTTTCGTCCTTGTACTTGGCGTCCTTCAGAA
TGTTGGCGAACTCGAACTTGACCCGCTCCCGTTCCGATCTCCGCATGCTG
CGCAGTGTGTCCACCAGCGATAGGCAGTAGAGCTCGATGGGATCGTTGAA
GGACGACGTCACTTGGGTCTGAAGCGGCGCTTGGGTTGCCTTGCGCTTGA
AGGGATTGGTCAGAAAATCGCTGGGTAATGCGCGTCTGATAGCCGCAGGC
TTGTAAATGGGCTCAATGGTCACTTCTCCGTTGGACAGCGAGCTATTCTT
GAACGGCTTTTGCTCCTGTGTCTGCTGCTGTTCTAGATGCACCTCCTGGC
CATAGCCATTGCCCATTACAACCATCGGCGTTAGCAGGGGCGAGGAGGCC
GGCGAGCTGGCTTGGTCATGTTCGTGGCTGTGATTGCTGCTGCTGGTGCC
GTTCAGTGTCGTCGGCAGGGATAATTGCTGCTTGGACTCTCCCATGACCA
GCTGCAACTCGGGCACAATCTCGTTGTCGTCGCTATTTGAGCCATCGTCG
CTGTTGTCCAGCTCGATGATGTCGTAGCCCTCGGAGGCGTCGATCTTTAG
GTGCTCCGGATCGGGATACAAAAAGCTATTGCTGTCGTTGTCACTTCCCA
TTCCATTCTGTTGGGCCACGTAGCTCTGGGATTTCTTCACATTGTAGGTT
TGGGCCGTGTTCTGCAGAAAGGATAGATCCTCAGTGAAGCGCCGCTTGCG
TACGTTCGGATTCGCCTGGCCCGTCTNCATCGCCTTGACCTCCTGCAGAT
AGTTGTATCGTATGTTCTTCCATTTGGTTTGCAGAAATCGGGGAGAGGCG
CCCAGTTCGTTGGCAATGCGATCCCATA

BO01477.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG12767-PA 1047 Dip3-RA 185..1044 878..19 4206 99.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dip3-RA 1471 CG12767-RA 368..1227 878..19 4244 99.5 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:09:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18129179..18130002 842..19 4094 99.8 Minus
Blast to na_te.dros performed 2015-02-11 02:09:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2328..2385 348..292 116 69 Minus
roo 9092 roo DM_ROO 9092bp 1064..1121 348..292 116 69 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6791 348..292 109 68.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6758..6812 348..292 109 68.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6779..6833 348..292 109 68.4 Minus

BO01477.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:19 Download gff for BO01477.3prime
Subject Subject Range Query Range Percent Splice Strand
Dip3-PA 186..1047 15..877 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:46 Download gff for BO01477.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12767-PA 186..1047 15..877 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 20:43:46 Download gff for BO01477.3prime
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 369..1231 14..877 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:45:19 Download gff for BO01477.3prime
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 369..1231 14..877 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 04:45:19 Download gff for BO01477.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 18129177..18130006 14..844 99   Minus
2R 18129067..18129099 845..877 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 20:43:46 Download gff for BO01477.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14016682..14017511 14..844 99   Minus
arm_2R 14016572..14016604 845..877 100 <- Minus

BO01477.5prime Sequence

764 bp (711 high quality bases) assembled on 2005-11-30

> BO01477.5prime
GAAGTTATCAGTCGACATGAGCCGAAAGAACGGAAACCAGGACACCTTTC
CCAAGACGGAGAAGATGCAGCGCTACTACGCGGAGCGCGAGACCACAGGA
CCCGAGTTCGACGATCGCCTGATAAAGCTTGTGCGCGCCAATCCGGCCAT
CTATGATGTCAGCCATCCGCACTATCGCCGTAATCCGGTGCGGGTGGACA
TATGGGATCGCATTGCCAACGAACTGGGCGCCTCCTCCCGATTTCTGCAA
ACCAAATGGAAGAACATACGATACAACTATCTGCAGGAGGTCAAGGCGAT
TGAGACGGGCCAGGCGAATCCGAACGTACGCAAGCGGCGCTTCACTGAGG
ATCTATCCTTTCTGCAGAACACGGCCCAAACCTACAATGTGAAGAAATCC
CAGAGCTACGTGGCCCAACAGAATGGAATGGGAAGTGACAACGACAGCAA
TAGCTTTTTGTATCCCGATCCGGAGCACCTAAAGATCGACGCCTCCGAGG
GCTACGACATCATCGAGCTGGACAACAGCGACGATGGCTCAAATAGCGAC
GACAACGAGATTGTGCCCGAGTTGCAGCTGGTCATGGGAGAGTCCAAGCA
GCAATTATCCCTGCCGACGACACTGAACGGCACCAGCAGCAGCAATCACA
GCCACGAACATGACCAAGCCAGCTCGCCGGCCTCCTCGCCCCTGCTAACG
CCGATGGTTGTAATGGGCAATGGCTATGGCCAGGAGGTGCATCTAGAACA
GCAGCAGACACAGG

BO01477.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG12767-PA 1047 Dip3-RA 1..748 17..764 3740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dip3-RA 1471 CG12767-RA 180..931 13..764 3745 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18129179..18129706 237..764 2640 100 Plus
2R 25286936 2R 18128975..18129101 110..236 635 100 Plus
2R 25286936 2R 18128673..18128770 13..110 475 99 Plus
Blast to na_te.dros performed on 2015-02-11 04:22:18 has no hits.

BO01477.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:20 Download gff for BO01477.5prime
Subject Subject Range Query Range Percent Splice Strand
Dip3-PA 1..748 17..764 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:47 Download gff for BO01477.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12767-PA 1..748 17..764 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 05:01:32 Download gff for BO01477.5prime
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 171..931 2..764 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:05:58 Download gff for BO01477.5prime
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 171..931 2..764 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:05:58 Download gff for BO01477.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 18129179..18129706 237..764 100   Plus
2R 18128976..18129101 111..236 100 -> Plus
2R 18128664..18128770 2..110 95 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 05:01:32 Download gff for BO01477.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14016684..14017211 237..764 100   Plus
arm_2R 14016481..14016606 111..236 100 -> Plus
arm_2R 14016169..14016275 2..110 95 -> Plus

BO01477.complete Sequence

1078 bp (1078 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629514

> BO01477.complete
GAAGTTATCAGTCGACATGAGCCGAAAGAACGGAAACCAGGACACCTTTC
CCAAGACGGAGAAGATGCAGCGCTACTACGCGGAGCGCGAGACCACAGGA
CCCGAGTTCGACGATCGCCTGATAAAGCTTGTGCGCGCCAATCCGGCCAT
CTATGATGTCAGCCATCCGCACTATCGCCGTAATCCGGTGCGGGTGGACA
TATGGGATCGCATTGCCAACGAACTGGGCGCCTCCTCCCGATTTCTGCAA
ACCAAATGGAAGAACATACGATACAACTATCTGCAGGAGGTCAAGGCGAT
TGAGACGGGCCAGGCGAATCCGAACGTACGCAAGCGGCGCTTCACTGAGG
ATCTATCCTTTCTGCAGAACACGGCCCAAACCTACAATGTGAAGAAATCC
CAGAGCTACGTGGCCCAACAGAATGGAATGGGAAGTGACAACGACAGCAA
TAGCTTTTTGTATCCCGATCCGGAGCACCTAAAGATCGACGCCTCCGAGG
GCTACGACATCATCGAGCTGGACAACAGCGACGATGGCTCAAATAGCGAC
GACAACGAGATTGTGCCCGAGTTGCAGCTGGTCATGGGAGAGTCCAAGCA
GCAATTATCCCTGCCGACGACACTGAACGGCACCAGCAGCAGCAATCACA
GCCACGAACATGACCAAGCCAGCTCGCCGGCCTCCTCGCCCCTGCTAACG
CCGATGGTTGTAATGGGCAATGGCTATGGCCAGGAGGTGCATCTAGAACA
GCAGCAGACACAGGAGCAAAAGCCGTTCAAGAATAGCTCGCTGTCCAACG
GAGAAGTGACCATTGAGCCCATTTACAAGCCTGCGGCTATCAGACGCGCA
TTACCCAGCGATTTTCTGACCAATCCCTTCAAGCGCAAGGCAACCCAAGC
GCCGCTTCAGACCCAAGTGACGTCGTCCTTCAACGATCCCATCGAGCTCT
ACTGCCTATCGCTGGTGGACACACTGCGCAGCATGCGGAGATCGGAACGG
GAGCGGGTCAAGTTCGAGTTCGCCAACATTCTGAAGGACGCCAAGTACAA
GGACGAAAGCGCAAGCTTTCTAGACCAT

BO01477.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dip3-RA 1047 CG12767-PA 1..1044 17..1060 5220 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dip3-RA 1471 CG12767-RA 180..1227 13..1060 5225 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18129179..18130002 237..1060 4120 100 Plus
2R 25286936 2R 18128975..18129101 110..236 635 100 Plus
2R 25286936 2R 18128673..18128770 13..110 475 99 Plus
Blast to na_te.dros performed 2014-11-28 01:03:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2328..2385 731..787 116 69 Plus
roo 9092 roo DM_ROO 9092bp 1064..1121 731..787 116 69 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6791 731..787 109 68.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6758..6812 731..787 109 68.4 Plus

BO01477.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:46:01 Download gff for BO01477.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 1..1047 17..1064 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:45 Download gff for BO01477.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 165..1225 2..1065 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:37:57 Download gff for BO01477.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 184..1227 17..1062 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:46:01 Download gff for BO01477.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 165..1225 2..1065 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:43:37 Download gff for BO01477.complete
Subject Subject Range Query Range Percent Splice Strand
Dip3-RA 184..1227 17..1062 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:43:37 Download gff for BO01477.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18129179..18130002 237..1062 99   Plus
2R 18128976..18129101 111..236 100 -> Plus
2R 18128677..18128770 17..110 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:37:57 Download gff for BO01477.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14016684..14017507 237..1062 99   Plus
arm_2R 14016481..14016606 111..236 100 -> Plus
arm_2R 14016182..14016275 17..110 100 -> Plus

BO01477.pep Sequence

Translation from 16 to 1078

> BO01477.pep
MSRKNGNQDTFPKTEKMQRYYAERETTGPEFDDRLIKLVRANPAIYDVSH
PHYRRNPVRVDIWDRIANELGASSRFLQTKWKNIRYNYLQEVKAIETGQA
NPNVRKRRFTEDLSFLQNTAQTYNVKKSQSYVAQQNGMGSDNDSNSFLYP
DPEHLKIDASEGYDIIELDNSDDGSNSDDNEIVPELQLVMGESKQQLSLP
TTLNGTSSSNHSHEHDQASSPASSPLLTPMVVMGNGYGQEVHLEQQQTQE
QKPFKNSSLSNGEVTIEPIYKPAAIRRALPSDFLTNPFKRKATQAPLQTQ
VTSSFNDPIELYCLSLVDTLRSMRRSERERVKFEFANILKDAKYKDESAS
FLDH

BO01477.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dip3-PA 348 CG12767-PA 1..348 1..348 1807 100 Plus