Clone BO01480 Report

Search the DGRC for BO01480

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:80
Vector:pDNR-Dual
Associated Gene/TranscriptSry-beta-RA
Protein status:BO01480.pep: full length peptide match
Sequenced Size:1102

Clone Sequence Records

BO01480.3prime Sequence

859 bp (745 high quality bases) assembled on 2005-11-30

> BO01480.3prime
ATGGTCTAGAAAGCTTGCAAAGAACGTGACGGTGGCTTCCTTGGCCTCCG
CCGACTCTGGCTTCTCGACCGGCTGGTGGACCCGCTTGTGCACCTTCAGG
GTGTACTTGTCCACGAACGATTTCTCGCAGTCGGGGCAGGGGTAGCGCGG
CCGGTCCGTCTGGTGGGTGCGCAAGTGGTGCTTGTAGGTGCGCTTGGTCT
TGAACTGCTGGTGGCACACCTCGCAGATCAGGGCGTTCTCCTCGGCGTCG
TGGCGCATCAGATGGTTGTACATCAGCCAGGAGAGCGAGAAGCGTTCGCC
GCACTTGTCGCACTGGTACTTCTTCTTGTCCCAGTGCACCTCCATGTGGC
GCAGGACGTTCCGCTTGTGCGAGAACTTTTTGTCGCAGTAGCGGCATTCA
AGTTCTGTTTTGCCCTCGTGCAAGTTCATATGCAGATCGAGTACCTCGTC
GTCCTTCACTTTCAAGCCACACACGTTGCAGGTGGCCTGCTCGCTCTTCT
GGCAGGTGTCCGCCTTGATGTGCCGCTCGAGCACCTCCTGGCTGGAAAAC
ATCTCGCCGCAGATATGGCAGGGTATCTCGGTGGTCTCGGTGAAGAACTC
CTCCTCCGACGACGGCATGCTGTCGTCCGGCTCGCTGAACTGGAACTCCT
CGTCCAGCATCTCCTCCTTCATGAATTCCTCGCACTCATCCTCCTCGCCC
GGCTGCCTTTCGGGCTCCTTGAGGGCGGTGGCCTGGACGATCTTGAAGGC
CGGCACCTGGACGCGGGCCCTCTTTGCCGCCTGTTGCTTGGTCTCCGCCT
TGCCCTCCACCTGCCTGCAGCCGAGCAGTGCGTCCGCAATCTGGCGCTGC
ACTTGGCTG

BO01480.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG7938-PA 1071 Sry-beta-RA 228..1068 859..19 4205 100 Minus
CG17958-PA 1302 Sry-delta-RA 815..855 338..298 180 97.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:22:32
Subject Length Description Subject Range Query Range Score Percent Strand
Sry-beta-RB 3300 CG7938-RB 322..1162 859..19 4205 100 Minus
Sry-beta-RA 1260 CG7938-RA 322..1162 859..19 4205 100 Minus
Sry-alpha-RB 3353 CG17957-RB 375..1215 859..19 4205 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30040093..30040933 859..19 4205 100 Minus
3R 32079331 3R 30044196..30044333 435..298 300 81.2 Minus
Blast to na_te.dros performed 2015-02-11 04:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\TRIM 3111 Dmir\TRIM DMTRIM 3126bp Derived from X59239 (Rel. 35, Last updated, Version 3). 127..162 616..581 117 80.6 Minus

BO01480.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:24 Download gff for BO01480.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7938-PA 228..1071 18..859 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:54 Download gff for BO01480.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7938-PA 228..1071 18..859 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 05:01:34 Download gff for BO01480.3prime
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 322..1162 19..859 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 06:06:36 Download gff for BO01480.3prime
Subject Subject Range Query Range Percent Splice Strand
Sry-alpha-RB 375..1215 19..859 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 06:06:36 Download gff for BO01480.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 30040093..30040933 19..859 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 05:01:34 Download gff for BO01480.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25865815..25866655 19..859 100   Minus

BO01480.5prime Sequence

855 bp (720 high quality bases) assembled on 2005-11-30

> BO01480.5prime
GAAGTTATCAGTCGACATGAGCTCCACGCGTCCGTTTTGCTTCGTTTGCG
GCAAGGAGAAGTCCGTGGGGGTGTTCCAGCTGATAGAAGGCTGCATTGTG
CCAGGAACCTTTAAGCCCATCAAGGATATACTGAAATACTTCGAGAAGAT
CATAAACCAGCGGCTGGAGCTCCTGCCCAACTCGGCCGCCTGCCGGGACT
GCCTGGAGTACCTCTTCAACTACGACAGGCTGGTGAGGAATCTCAGCCAA
GTGCAGCGCCAGATTGCGGACGCACTGCTCGGCTGCAGGCAGGTGGAGGG
CAAGGCGGAGACCAAGCAACAGGCGGCAAAGAGGGCCCGCGTCCAGGTGC
CGGCCTTCAAGATCGTCCAGGCCACCGCCCTCAAGGAGCCCGAAAGGCAG
CCGGGCGAGGAGGATGAGTGCGAGGAATTCATGAAGGAGGAGATGCTGGA
CGAGGAGTTCCAGTTCAGCGAGCCGGACGACAGCATGCCGTCGTCGGAGG
AGGAGTTCTTCACCGAGACCACCGAGATACCCTGCCATATCTGCGGCGAG
ATGTTTTCCAGCCAGGAGGTGCTCGAGCGGCACATCAAGGCGGACACCTG
CCAGAAGAGCGAGCAGGCCACCTGCAACGTGTGTGGCTTGAAAGTGAAGG
ACGACGAGGTACTCGATCTGCATATGAACTTGCACGAGGGCAAAACAGAA
CTTGAATGCCGCTACTGCGACAAAAAGTTCTCGCACAAGCGGAACGTCCT
GCGCCACATGGAGGTGCACTGGGACAAGAAGAAGTACCAGTGCGACAAGT
GCGGCGAACGCTTCTCGCTCTCCTGGCTGATGTACAACCATCTGATGCGC
CACGA

BO01480.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG7938-PA 1071 Sry-beta-RA 1..839 17..855 4195 100 Plus
CG17958-PA 1302 Sry-delta-RA 815..855 765..805 180 97.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
Sry-beta-RB 3300 CG7938-RB 95..933 17..855 4195 100 Plus
Sry-beta-RA 1260 CG7938-RA 95..933 17..855 4195 100 Plus
Sry-alpha-RB 3353 CG17957-RB 219..986 88..855 3840 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30039937..30040704 88..855 3840 100 Plus
3R 32079331 3R 30039813..30039886 17..90 370 100 Plus
3R 32079331 3R 30044196..30044333 668..805 300 81.2 Plus
Blast to na_te.dros performed 2015-02-10 15:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\TRIM 3111 Dmir\TRIM DMTRIM 3126bp Derived from X59239 (Rel. 35, Last updated, Version 3). 127..162 487..522 117 80.6 Plus

BO01480.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:25 Download gff for BO01480.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7938-PA 1..838 17..854 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:55 Download gff for BO01480.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7938-PA 1..838 17..854 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 02:34:57 Download gff for BO01480.5prime
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 95..932 17..854 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:16:54 Download gff for BO01480.5prime
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 95..932 17..854 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:16:54 Download gff for BO01480.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 30039939..30040703 90..854 100   Plus
3R 30039813..30039885 17..89 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 02:34:57 Download gff for BO01480.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25865661..25866425 90..854 100   Plus
arm_3R 25865535..25865607 17..89 100 -> Plus

BO01480.complete Sequence

1102 bp (1102 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629515

> BO01480.complete
GAAGTTATCAGTCGACATGAGCTCCACGCGTCCGTTTTGCTTCGTTTGCG
GCAAGGAGAAGTCCGTGGGGGTGTTCCAGCTGATAGAAGGCTGCATTGTG
CCAGGAACCTTTAAGCCCATCAAGGATATACTGAAATACTTCGAGAAGAT
CATAAACCAGCGGCTGGAGCTCCTGCCCAACTCGGCCGCCTGCCGGGACT
GCCTGGAGTACCTCTTCAACTACGACAGGCTGGTGAGGAATCTCAGCCAA
GTGCAGCGCCAGATTGCGGACGCACTGCTCGGCTGCAGGCAGGTGGAGGG
CAAGGCGGAGACCAAGCAACAGGCGGCAAAGAGGGCCCGCGTCCAGGTGC
CGGCCTTCAAGATCGTCCAGGCCACCGCCCTCAAGGAGCCCGAAAGGCAG
CCGGGCGAGGAGGATGAGTGCGAGGAATTCATGAAGGAGGAGATGCTGGA
CGAGGAGTTCCAGTTCAGCGAGCCGGACGACAGCATGCCGTCGTCGGAGG
AGGAGTTCTTCACCGAGACCACCGAGATACCCTGCCATATCTGCGGCGAG
ATGTTTTCCAGCCAGGAGGTGCTCGAGCGGCACATCAAGGCGGACACCTG
CCAGAAGAGCGAGCAGGCCACCTGCAACGTGTGTGGCTTGAAAGTGAAGG
ACGACGAGGTACTCGATCTGCATATGAACTTGCACGAGGGCAAAACAGAA
CTTGAATGCCGCTACTGCGACAAAAAGTTCTCGCACAAGCGGAACGTCCT
GCGCCACATGGAGGTGCACTGGGACAAGAAGAAGTACCAGTGCGACAAGT
GCGGCGAACGCTTCTCGCTCTCCTGGCTGATGTACAACCATCTGATGCGC
CACGACGCCGAGGAGAACGCCCTGATCTGCGAGGTGTGCCACCAGCAGTT
CAAGACCAAGCGCACCTACAAGCACCACTTGCGCACCCACCAGACGGACC
GGCCGCGCTACCCCTGCCCCGACTGCGAGAAATCGTTCGTGGACAAGTAC
ACCCTGAAGGTGCACAAGCGGGTCCACCAGCCGGTCGAGAAGCCAGAGTC
GGCGGAGGCCAAGGAAGCCACCGTCACGTTCTTTGCAAGCTTTCTAGACC
AT

BO01480.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:16:29
Subject Length Description Subject Range Query Range Score Percent Strand
Sry-beta-RB 1071 CG7938-PB 1..1068 17..1084 5340 100 Plus
Sry-beta-RA 1071 CG7938-PA 1..1068 17..1084 5340 100 Plus
Sry-delta-RA 1302 CG17958-PA 718..855 668..805 300 81.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:16:30
Subject Length Description Subject Range Query Range Score Percent Strand
Sry-beta-RB 3300 CG7938-RB 95..1162 17..1084 5340 100 Plus
Sry-beta-RA 1260 CG7938-RA 95..1162 17..1084 5340 100 Plus
Sry-alpha-RB 3353 CG17957-RB 219..1215 88..1084 4985 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30039937..30040933 88..1084 4985 100 Plus
3R 32079331 3R 30039813..30039886 17..90 370 100 Plus
3R 32079331 3R 30044196..30044333 668..805 300 81.2 Plus
Blast to na_te.dros performed 2014-11-27 13:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\TRIM 3111 Dmir\TRIM DMTRIM 3126bp Derived from X59239 (Rel. 35, Last updated, Version 3). 127..162 487..522 117 80.6 Plus

BO01480.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:47 Download gff for BO01480.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 1..1071 17..1085 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:26 Download gff for BO01480.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 82..1149 17..1084 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:28:27 Download gff for BO01480.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 95..1162 17..1086 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:48 Download gff for BO01480.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 82..1149 17..1084 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:14:37 Download gff for BO01480.complete
Subject Subject Range Query Range Percent Splice Strand
Sry-beta-RA 95..1162 17..1086 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:14:37 Download gff for BO01480.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30039939..30040933 90..1086 99   Plus
3R 30039813..30039885 17..89 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:28:27 Download gff for BO01480.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25865661..25866655 90..1086 99   Plus
arm_3R 25865535..25865607 17..89 100 -> Plus

BO01480.pep Sequence

Translation from 16 to 1102

> BO01480.pep
MSSTRPFCFVCGKEKSVGVFQLIEGCIVPGTFKPIKDILKYFEKIINQRL
ELLPNSAACRDCLEYLFNYDRLVRNLSQVQRQIADALLGCRQVEGKAETK
QQAAKRARVQVPAFKIVQATALKEPERQPGEEDECEEFMKEEMLDEEFQF
SEPDDSMPSSEEEFFTETTEIPCHICGEMFSSQEVLERHIKADTCQKSEQ
ATCNVCGLKVKDDEVLDLHMNLHEGKTELECRYCDKKFSHKRNVLRHMEV
HWDKKKYQCDKCGERFSLSWLMYNHLMRHDAEENALICEVCHQQFKTKRT
YKHHLRTHQTDRPRYPCPDCEKSFVDKYTLKVHKRVHQPVEKPESAEAKE
ATVTFFASFLDH

BO01480.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Sry-beta-PB 356 CG7938-PB 1..356 1..356 1928 100 Plus
Sry-beta-PA 356 CG7938-PA 1..356 1..356 1928 100 Plus
Sry-delta-PA 433 CG17958-PA 30..360 28..338 597 35.9 Plus
CG7928-PA 457 CG7928-PA 195..420 119..338 295 30.3 Plus
Opbp-PA 562 CG30443-PA 188..405 136..337 273 27.5 Plus
CG7928-PA 457 CG7928-PA 70..367 44..342 173 25.6 Plus
CG7928-PA 457 CG7928-PA 311..450 170..306 165 28.2 Plus