Clone BO01483 Report

Search the DGRC for BO01483

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:83
Vector:pDNR-Dual
Associated Gene/Transcriptexd-RA
Protein status:BO01483.pep:
Sequenced Size:1162

Clone Sequence Records

BO01483.3prime Sequence

863 bp (770 high quality bases) assembled on 2005-11-30

> BO01483.3prime
ATGGTCTAGAAAGCTTGCGGGGCTTAGATCCTGATGGAGATTTGGGTCGT
AGCCGCCCATGCTGTTGTCGTACGGTTGCTGCTGGTCGTATCCGCCGGAG
CCCATTGGATAGCCCATGGAATCCTGTGGCGGAGCGGGTGACATCATGGG
TGTGGTTGTCCCGCTGGGTGGACCGGCCATGGAATACGGTGAAGCACCAG
CCGCCTTCTTGGCCGCATACAAATTGGCCTCCTCCTGTGCCTTACCAATG
TTCTTCTTATAGCGAATACGCTTGTTGCCAAACCAATTCGATACTTGCGA
GACCGTGATGCCACACTTTCGTGCCAACTCCTCTTTGGCCTCTTCGGATG
GATATGGGTTGCTCAAGTGACTGTAGAAGTACTCGTTGAGAATCTCGGAT
GCCTGCTTGCTGAAATTGCGGCGTTTGCGGCGTGCGTCCAGGAAACGCGA
ACGAAGTATCATTACAGCCTCGCAGGTCGACTGCTTCAGCTGCATTTGTA
TGGAACTAAACTTTTTGTGGATGATCTGCACCATTCGCTCGATTTCCTTT
GGTGTAATGGGTCTCGTGCGACTCTGTTCGCGTAGAAGATTCATGACATG
CGTGGTGAACTCGTTGCATGCCTGCTCGTACTTCTCCAATTCCTGGTGAT
ATATTTGACGGATCTGTGCCAGCTTGGCACGGTAGTCGGAATGCTCAATG
GCATTGTCAGCACCATCGATGGACAGGGAACCGCCCTGGCTGGCCGCAGC
CGCAGAGGCAGCCGCTGCTCCGCCACCGCCCTTCTCGGGTCCGGCCACGC
CCTCGGCAATCAGCATGTTGTCCAAGCGCATCAGTTTGCGATCTGGGGGC
TCCTCCTCCTGGG

BO01483.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG8933-PB 1131 exd-RB 311..1128 836..19 4090 100 Minus
CG8933-PA 1131 exd-RA 311..1128 836..19 4090 100 Minus
CG8933-PC 1131 exd-RC 311..1128 836..19 4090 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
exd-RE 2883 CG8933-RE 499..1343 863..19 4180 99.8 Minus
exd-RD 2930 CG8933-RD 546..1390 863..19 4180 99.8 Minus
exd-RA 2386 CG8933-RA 515..1359 863..19 4180 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15993983..15994283 863..563 1460 99 Minus
X 23542271 X 15994684..15994969 304..19 1430 100 Minus
X 23542271 X 15994345..15994607 564..302 1315 100 Minus
Blast to na_te.dros performed on 2015-02-12 16:06:24 has no hits.

BO01483.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:26 Download gff for BO01483.3prime
Subject Subject Range Query Range Percent Splice Strand
exd-PC 284..1131 16..863 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:56 Download gff for BO01483.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8933-PC 284..1131 16..863 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:24:30 Download gff for BO01483.3prime
Subject Subject Range Query Range Percent Splice Strand
exd-RA 515..1359 19..863 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:41:17 Download gff for BO01483.3prime
Subject Subject Range Query Range Percent Splice Strand
exd-RA 515..1359 19..863 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:41:17 Download gff for BO01483.3prime
Subject Subject Range Query Range Percent Splice Strand
X 15994685..15994969 19..303 100   Minus
X 15994347..15994605 304..562 100 -> Minus
X 15993983..15994283 563..863 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:24:30 Download gff for BO01483.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 15888718..15889002 19..303 100   Minus
arm_X 15888380..15888638 304..562 100 -> Minus
arm_X 15888016..15888316 563..863 99 -> Minus

BO01483.5prime Sequence

824 bp (733 high quality bases) assembled on 2005-11-30

> BO01483.5prime
GAAGTTATCAGTCGACATGGAGGACCCCAATCGCATGTTGGCCCACACCG
GCGGCATGATGGCTCCGCAAGGATACGGCTTGTCTGGCCAGGATGATGGC
CAGAATGCCGGCAGCGAGAACGAGGTGCGCAAGCAGAAGGACATCGGCGA
GATATTGCAACAGATAATGAGTATCTCGGAGCAATCACTTGACGAGGCCC
AGGCCAGAAAACATACACTAAACTGTCACCGAATGAAGCCGGCACTTTTC
TCTGTACTTTGCGAAATCAAGGAGAAGACCGTCCTCTCGATTCGCAACAC
CCAGGAGGAGGAGCCCCCAGATCCGCAACTGATGCGCTTGGACAACATGC
TGATTGCCGAGGGCGTGGCCGGACCCGAGAAGGGCGGTGGCGGAGCAGCG
GCTGCCTCTGCGGCTGCGGCCAGCCAGGGCGGTTCCCTGTCCATCGATGG
TGCTGACAATGCCATTGAGCATTCCGACTACCGTGCCAAGCTGGCACAGA
TCCGTCAAATATATCACCAGGAATTGGAGAAGTACGAGCAGGCATGCAAC
GAGTTCACCACGCATGTCATGAATCTTCTACGCGAACAGAGTCGCACGAG
ACCCATTACACCAAAGGAAATCGAGCGAATGGTGCAGATCATCCACAAAA
AGTTTAGTTCCATACAAATGCAGCTGAAGCAGTCGACCTGCGAGGCTGTA
ATGATACTTCGTTCGCGTTTCCTGGACGCACGCCGCAAACGCCGCAATTT
CAGCAAGCAGGCATCCGAGATTCTCAACGAGTACTTCTACAGTCACTTGA
GCAACCCATATCCATCCGAAGAGG

BO01483.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG8933-PB 1131 exd-RB 1..808 17..824 4040 100 Plus
CG8933-PA 1131 exd-RA 1..808 17..824 4040 100 Plus
CG8933-PC 1131 exd-RC 1..808 17..824 4040 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
exd-RE 2883 CG8933-RE 215..1023 16..824 4045 100 Plus
exd-RD 2930 CG8933-RD 262..1070 16..824 4045 100 Plus
exd-RA 2386 CG8933-RA 231..1039 16..824 4045 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15993964..15994283 281..600 1600 100 Plus
X 23542271 X 15993508..15993773 16..281 1330 100 Plus
X 23542271 X 15994345..15994570 599..824 1130 100 Plus
Blast to na_te.dros performed on 2015-02-11 15:42:12 has no hits.

BO01483.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:27 Download gff for BO01483.5prime
Subject Subject Range Query Range Percent Splice Strand
exd-PC 1..808 17..824 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:29:58 Download gff for BO01483.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8933-PC 1..808 17..824 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:48:11 Download gff for BO01483.5prime
Subject Subject Range Query Range Percent Splice Strand
exd-RA 231..1039 16..824 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:13:28 Download gff for BO01483.5prime
Subject Subject Range Query Range Percent Splice Strand
exd-RA 231..1039 16..824 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:13:28 Download gff for BO01483.5prime
Subject Subject Range Query Range Percent Splice Strand
X 15994347..15994570 601..824 100   Plus
X 15993965..15994283 282..600 100 -> Plus
X 15993508..15993773 16..281 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:48:11 Download gff for BO01483.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 15888380..15888603 601..824 100   Plus
arm_X 15887998..15888316 282..600 100 -> Plus
arm_X 15887541..15887806 16..281 100 -> Plus

BO01483.complete Sequence

1162 bp (1162 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629516

> BO01483.complete
GAAGTTATCAGTCGACATGGAGGACCCCAATCGCATGTTGGCCCACACCG
GCGGCATGATGGCTCCGCAAGGATACGGCTTGTCTGGCCAGGATGATGGC
CAGAATGCCGGCAGCGAGAACGAGGTGCGCAAGCAGAAGGACATCGGCGA
GATATTGCAACAGATAATGAGTATCTCGGAGCAATCACTTGACGAGGCCC
AGGCCAGAAAACATACACTAAACTGTCACCGAATGAAGCCGGCACTTTTC
TCTGTACTTTGCGAAATCAAGGAGAAGACCGTCCTCTCGATTCGCAACAC
CCAGGAGGAGGAGCCCCCAGATCCGCAACTGATGCGCTTGGACAACATGC
TGATTGCCGAGGGCGTGGCCGGACCCGAGAAGGGCGGTGGCGGAGCAGCG
GCTGCCTCTGCGGCTGCGGCCAGCCAGGGCGGTTCCCTGTCCATCGATGG
TGCTGACAATGCCATTGAGCATTCCGACTACCGTGCCAAGCTGGCACAGA
TCCGTCAAATATATCACCAGGAATTGGAGAAGTACGAGCAGGCATGCAAC
GAGTTCACCACGCATGTCATGAATCTTCTACGCGAACAGAGTCGCACGAG
ACCCATTACACCAAAGGAAATCGAGCGAATGGTGCAGATCATCCACAAAA
AGTTTAGTTCCATACAAATGCAGCTGAAGCAGTCGACCTGCGAGGCTGTA
ATGATACTTCGTTCGCGTTTCCTGGACGCACGCCGCAAACGCCGCAATTT
CAGCAAGCAGGCATCCGAGATTCTCAACGAGTACTTCTACAGTCACTTGA
GCAACCCATATCCATCCGAAGAGGCCAAAGAGGAGTTGGCACGAAAGTGT
GGCATCACGGTCTCGCAAGTATCGAATTGGTTTGGCAACAAGCGTATTCG
CTATAAGAAGAACATTGGTAAGGCACAGGAGGAGGCCAATTTGTATGCGG
CCAAGAAGGCGGCTGGTGCTTCACCGTATTCCATGGCCGGTCCACCCAGC
GGGACAACCACACCCATGATGTCACCCGCTCCGCCACAGGATTCCATGGG
CTATCCAATGGGCTCCGGCGGATACGACCAGCAGCAACCGTACGACAACA
GCATGGGCGGCTACGACCCAAATCTCCATCAGGATCTAAGCCCCGCAAGC
TTTCTAGACCAT

BO01483.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:53:32
Subject Length Description Subject Range Query Range Score Percent Strand
exd-RE 1131 CG8933-PE 1..1128 17..1144 5640 100 Plus
exd-RD 1131 CG8933-PD 1..1128 17..1144 5640 100 Plus
exd-RA 1131 CG8933-PA 1..1128 17..1144 5640 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
exd-RE 2883 CG8933-RE 215..1343 16..1144 5645 100 Plus
exd-RD 2930 CG8933-RD 262..1390 16..1144 5645 100 Plus
exd-RA 2386 CG8933-RA 231..1359 16..1144 5645 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15993964..15994283 281..600 1600 100 Plus
X 23542271 X 15994684..15994969 859..1144 1430 100 Plus
X 23542271 X 15993508..15993773 16..281 1330 100 Plus
X 23542271 X 15994345..15994607 599..861 1315 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:53:31 has no hits.

BO01483.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:48 Download gff for BO01483.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RC 1..1131 17..1147 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:28 Download gff for BO01483.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RC 256..1384 16..1144 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:34:52 Download gff for BO01483.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RA 232..1359 17..1146 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:49 Download gff for BO01483.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RC 256..1384 16..1144 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:29:00 Download gff for BO01483.complete
Subject Subject Range Query Range Percent Splice Strand
exd-RA 232..1359 17..1146 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:29:00 Download gff for BO01483.complete
Subject Subject Range Query Range Percent Splice Strand
X 15994685..15994969 860..1146 99   Plus
X 15994347..15994605 601..859 100 -> Plus
X 15993965..15994283 282..600 100 -> Plus
X 15993509..15993773 17..281 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:34:52 Download gff for BO01483.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15888718..15889002 860..1146 99   Plus
arm_X 15888380..15888638 601..859 100 -> Plus
arm_X 15887998..15888316 282..600 100 -> Plus
arm_X 15887542..15887806 17..281 100 -> Plus

BO01483.pep Sequence

Translation from 16 to 1162

> BO01483.pep
MEDPNRMLAHTGGMMAPQGYGLSGQDDGQNAGSENEVRKQKDIGEILQQI
MSISEQSLDEAQARKHTLNCHRMKPALFSVLCEIKEKTVLSIRNTQEEEP
PDPQLMRLDNMLIAEGVAGPEKGGGGAAAASAAAASQGGSLSIDGADNAI
EHSDYRAKLAQIRQIYHQELEKYEQACNEFTTHVMNLLREQSRTRPITPK
EIERMVQIIHKKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNFSKQAS
EILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI
GKAQEEANLYAAKKAAGASPYSMAGPPSGTTTPMMSPAPPQDSMGYPMGS
GGYDQQQPYDNSMGGYDPNLHQDLSPASFLDH

BO01483.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
exd-PE 376 CG8933-PE 1..376 1..376 1953 100 Plus
exd-PD 376 CG8933-PD 1..376 1..376 1953 100 Plus
exd-PA 376 CG8933-PA 1..376 1..376 1953 100 Plus
exd-PB 376 CG8933-PB 1..376 1..376 1953 100 Plus
hth-PA 472 CG17117-PA 351..457 239..372 155 30.6 Plus