Clone BO01486 Report

Search the DGRC for BO01486

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:86
Vector:pDNR-Dual
Associated Gene/Transcriptl(3)neo38-RA
Protein status:BO01486.pep: full length peptide match
Sequenced Size:1174

Clone Sequence Records

BO01486.3prime Sequence

871 bp (737 high quality bases) assembled on 2005-11-30

> BO01486.3prime
ATGGTCTAGAAAGCTTGCGGAGCCGTGCAGCGCGTTGCTCTGCGCACTGT
TGCCGCCTCCACCGCCGCCACCGCCTCCGGCGGATCCGTTAACGTTCTGC
GCCGACACCTCCGACTTGACACGCCGGGCGATGTGCGATCGTGTGTGCTT
GCGCAAGTGATCCTTGCGATAGAAACCTTTTCCACACTCAATGCAAACAT
GCTTCTTCTCGCCGGAATGGATGACAATGTGCAGAGTGAGCTGCTCCTTG
CGCTTGAAGGACTTCATGCAGATATTGCACACATGCGGCCTGTCCGGTAT
GTGGGAGAGCTTGTGCCTGGTCAGGTGGTCCTTGCGCTTCAGCGCCGCAT
TGCAGATGTCGCAGACGAAGCGCCGCTCAACGGCGTGCGAGATGACGTGC
TGCTCGATGAGGCTGCGATCCGGGTAGGCCATTTGGCACTCCGGGCAGCA
GTAGAGCGTCGAGCCATCCAGCGCCTTTGTCTCGCGGATTTCTCCCGGTT
TGGGGCGCGGCTTCTTCTCCTTTGGTGGTTTCTTCTTTTTGGTCTTCTTG
CCGCTGGCCGTGCCTGTGCCGCCGCTGGCGTTTGTTGTGCCCACAGATCC
GGAGCTCGAGACGGCGCCGGCGCCACCATTGGTCACAGTGCCGTTAGCAT
TGCCATTCACTCCGTTGCTAGCTCCGTTCGTCAGCGCCGCTCCGTTGGCG
TCCGTCATGTTGGTCATGTGACCGCCATGGTCCATGCCCACCAGTCCGTT
GTGGTGGCCGCCATTCGCACCGTTGTTGCTGGGGCGTAGGGCCACGCCCC
CCAGCGCCAGGCTGGCCAAAATTTGTGCCGTTCTTCAGGACATCGCCCGG
TGGACTCCTTCTTGATCGTCT

BO01486.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG6930-PA 1143 CG6930-RA 376..1140 783..19 3825 100 Minus
CG6930-PB 1344 CG6930-RB 577..1341 783..19 3825 100 Minus
CG6930-PC 1344 CG6930-RC 577..1341 783..19 3825 100 Minus
CG6930-PA 1143 CG6930-RA 339..372 820..787 170 100 Minus
CG6930-PB 1344 CG6930-RB 540..573 820..787 170 100 Minus
CG6930-PC 1344 CG6930-RC 540..573 820..787 170 100 Minus
CG7368-PB 1593 CG7368-RB 1169..1230 266..205 160 90.3 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 12:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-RL 2247 CG6930-RL 1165..2015 871..19 4155 99.4 Minus
l(3)neo38-RK 1611 CG6930-RK 529..1379 871..19 4155 99.4 Minus
l(3)neo38-RJ 3691 CG6930-RJ 394..1244 871..19 4155 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 12:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11769370..11769965 274..871 2830 99 Plus
3R 32079331 3R 11768843..11769002 19..178 800 100 Plus
3R 32079331 3R 11769056..11769154 175..273 495 100 Plus
3L 28110227 3L 11603938..11604196 373..115 470 78.8 Minus
Blast to na_te.dros performed on 2015-02-13 12:25:55 has no hits.

BO01486.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:30 Download gff for BO01486.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6930-PA 290..1143 16..871 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:02 Download gff for BO01486.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6930-PB 491..1344 16..871 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:35:36 Download gff for BO01486.3prime
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RJ 394..1244 19..871 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:36:12 Download gff for BO01486.3prime
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RJ 394..1244 19..871 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:36:12 Download gff for BO01486.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 11769370..11769965 274..871 99   Plus
3R 11769058..11769154 177..273 100 <- Plus
3R 11768843..11769000 19..176 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:35:36 Download gff for BO01486.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7595092..7595687 274..871 99   Plus
arm_3R 7594780..7594876 177..273 100 <- Plus
arm_3R 7594565..7594722 19..176 100 <- Plus

BO01486.5prime Sequence

854 bp (670 high quality bases) assembled on 2005-11-30

> BO01486.5prime
GAAGTTATCAGTCGACATGTTTTCGGCTGCCAACAACATGCAATATGGCC
AGAATATCTCCATACCGTACTCACAGCCGCAGGGTGATCTAAACTTTCTC
AATGCAGCCGCTGCGGCCGATCATAAGGGTAAAATCCATCCAAAAATCGA
ACGTGACCGGGAAGAAGTCCTCAACCAGCAGATCCTGCAGAATGTCAACC
AATCCTGGCAGACGTTGGCAAATACGGCCAACACGGTGGACTACTCGTCA
CACCTGCTCTCCGCCACACTGCCCATCTCCATACAGCACTTCCTCAAGTA
CTCGGAGACGATCAAGAAGGAGTCCACCGGCGATGTCCTGAAGAACGGCA
CAAATTTGGCCAGCCTGGCGCTGGGGGGCGTGGCCCTAACGCCCAGCAAC
AACGGTGCGAATGGCGGCCACCACAACGGACTGGTGGGCATGGACCATGG
CGGTCACATGACCAACATGACGGACGCCAACGGAGCGGCGCTGACGAACG
GAGCTAGCAACGGAGTGAATGGCAATGCTAACGGCACTGTGACCAATGGT
GGCGCCGGCGCCGTCTCGAGCTCCGGATCTGTGGGCACAACAAACGCCAG
CGGCGGCACAGGCACGGCCAGCGGCAAGAAGACCAAAAAGAAGAAACCAC
CAAAGGAGAAGAAGCCGCGCCCCAAACCGGGAGAAATCCGCGAGACAAAG
GCGCTGGATGGCTCGACGCTCTACTGCTGCCCGGAGTGCCAAATGGCCTA
CCCGGATCGCAGCCTCATCGAGCAGCACGTCATCTCGCACGCCGTTGAGC
GGCGCTTCGTCTGCGACATCTGCAATGCGGCGCTGAAGCGCAAGGACCAC
CTGA

BO01486.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG6930-PA 1143 CG6930-RA 1..838 17..854 4165 99.8 Plus
CG6930-PB 1344 CG6930-RB 206..1039 21..854 4145 99.8 Plus
CG6930-PC 1344 CG6930-RC 206..1039 21..854 4145 99.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 23:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-RA 1522 CG6930-RA 151..988 17..854 4175 99.9 Plus
l(3)neo38-RL 2247 CG6930-RL 880..1713 21..854 4155 99.9 Plus
l(3)neo38-RK 1611 CG6930-RK 244..1077 21..854 4155 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 23:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11769417..11770105 854..166 3430 99.9 Minus
3R 32079331 3R 11771154..11771300 167..21 735 100 Minus
Blast to na_te.dros performed on 2015-02-12 23:55:13 has no hits.

BO01486.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:31 Download gff for BO01486.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6930-PA 1..837 17..853 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:03 Download gff for BO01486.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6930-PA 1..837 17..853 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 20:21:55 Download gff for BO01486.5prime
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 146..987 8..853 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:26:56 Download gff for BO01486.5prime
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 146..987 8..853 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:26:56 Download gff for BO01486.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 11771154..11771303 16..167 98   Minus
3R 11769418..11770103 168..853 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 20:21:55 Download gff for BO01486.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7596876..7597025 16..167 98   Minus
arm_3R 7595140..7595825 168..853 99 <- Minus

BO01486.complete Sequence

1174 bp (1174 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629517

> BO01486.complete
GAAGTTATCAGTCGACATGTTTTCGGCTGCCAACAACATGCAATATGGCC
AGAATATCTCCATACCGTACTCACAGCCGCAGGGTGATCTAAACTTTCTC
AATGCAGCCGCTGCGGCCGATCATAAGGGTAAAATCCATCCAAAAATCGA
ACGTGACCGGGAAGAAGTCCTCAACCAGCAGATCCTGCAGAATGTCAACC
AATCCTGGCAGACGTTGGCAAATACGGCCAACACGGTGGACTACTCGTCA
CACCTGCTCTCCGCCACACTGCCCATCTCCATACAGCACTTCCTCAAGTA
CTCGGAGACGATCAAGAAGGAGTCCACCGGCGATGTCCTGAAGAACGGCA
CAAATTTGGCCAGCCTGGCGCTGGGGGGCGTGGCCCTAACGCCCAGCAAC
AACGGTGCGAATGGCGGCCACCACAACGGACTGGTGGGCATGGACCATGG
CGGTCACATGACCAACATGACGGACGCCAACGGAGCGGCGCTGACGAACG
GAGCTAGCAACGGAGTGAATGGCAATGCTAACGGCACTGTGACCAATGGT
GGCGCCGGCGCCGTCTCGAGCTCCGGATCTGTGGGCACAACAAACGCCAG
CGGCGGCACAGGCACGGCCAGCGGCAAGAAGACCAAAAAGAAGAAACCAC
CAAAGGAGAAGAAGCCGCGCCCCAAACCGGGAGAAATCCGCGAGACAAAG
GCGCTGGATGGCTCGACGCTCTACTGCTGCCCGGAGTGCCAAATGGCCTA
CCCGGATCGCAGCCTCATCGAGCAGCACGTCATCTCGCACGCCGTTGAGC
GGCGCTTCGTCTGCGACATCTGCAATGCGGCGCTGAAGCGCAAGGACCAC
CTGACCAGGCACAAGCTCTCCCACATACCGGACAGGCCGCATGTGTGCAA
TATCTGCATGAAGTCCTTCAAGCGCAAGGAGCAGCTCACTCTGCACATTG
TCATCCATTCCGGCGAGAAGAAGCATGTTTGCATTGAGTGTGGAAAAGGT
TTCTATCGCAAGGATCACTTGCGCAAGCACACACGATCGCACATCGCCCG
GCGTGTCAAGTCGGAGGTGTCGGCGCAGAACGTTAACGGATCCGCCGGAG
GCGGTGGCGGCGGTGGAGGCGGCAACAGTGCGCAGAGCAACGCGCTGCAC
GGCTCCGCAAGCTTTCTAGACCAT

BO01486.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-RA 1143 CG6930-PA 1..1140 17..1156 5685 99.9 Plus
l(3)neo38-RL 1368 CG6930-PL 206..1341 21..1156 5665 99.9 Plus
l(3)neo38-RK 1344 CG6930-PK 206..1341 21..1156 5665 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:44:28
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-RA 1522 CG6930-RA 151..1290 17..1156 5685 99.9 Plus
l(3)neo38-RL 2247 CG6930-RL 880..2015 21..1156 5665 99.9 Plus
l(3)neo38-RK 1611 CG6930-RK 244..1379 21..1156 5665 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11769370..11770105 901..166 3665 99.9 Minus
3R 32079331 3R 11768843..11769002 1156..997 800 100 Minus
3R 32079331 3R 11771154..11771300 167..21 735 100 Minus
3R 32079331 3R 11769056..11769154 1000..902 495 100 Minus
3L 28110227 3L 11603938..11604196 802..1060 470 78.8 Plus
Blast to na_te.dros performed on 2014-11-27 14:44:26 has no hits.

BO01486.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:50 Download gff for BO01486.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 1..1143 17..1159 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:30 Download gff for BO01486.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 146..1290 8..1156 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:32:21 Download gff for BO01486.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 158..1290 24..1158 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:50 Download gff for BO01486.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 146..1290 8..1156 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:51:44 Download gff for BO01486.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo38-RA 158..1290 24..1158 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:51:44 Download gff for BO01486.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11771154..11771297 24..167 100   Minus
3R 11769370..11770103 168..901 99 <- Minus
3R 11769058..11769154 902..998 100 <- Minus
3R 11768840..11769000 999..1158 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:32:21 Download gff for BO01486.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7596876..7597019 24..167 100   Minus
arm_3R 7595092..7595825 168..901 99 <- Minus
arm_3R 7594780..7594876 902..998 100 <- Minus
arm_3R 7594562..7594722 999..1158 98 <- Minus

BO01486.pep Sequence

Translation from 16 to 1174

> BO01486.pep
MFSAANNMQYGQNISIPYSQPQGDLNFLNAAAAADHKGKIHPKIERDREE
VLNQQILQNVNQSWQTLANTANTVDYSSHLLSATLPISIQHFLKYSETIK
KESTGDVLKNGTNLASLALGGVALTPSNNGANGGHHNGLVGMDHGGHMTN
MTDANGAALTNGASNGVNGNANGTVTNGGAGAVSSSGSVGTTNASGGTGT
ASGKKTKKKKPPKEKKPRPKPGEIRETKALDGSTLYCCPECQMAYPDRSL
IEQHVISHAVERRFVCDICNAALKRKDHLTRHKLSHIPDRPHVCNICMKS
FKRKEQLTLHIVIHSGEKKHVCIECGKGFYRKDHLRKHTRSHIARRVKSE
VSAQNVNGSAGGGGGGGGGNSAQSNALHGSASFLDH

BO01486.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:19:29
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo38-PA 380 CG6930-PA 1..380 1..380 2013 100 Plus
l(3)neo38-PK 447 CG6930-PK 70..447 3..380 2002 100 Plus
l(3)neo38-PC 447 CG6930-PC 70..447 3..380 2002 100 Plus
l(3)neo38-PB 447 CG6930-PB 70..447 3..380 2002 100 Plus
l(3)neo38-PL 455 CG6930-PL 70..447 3..380 2002 100 Plus