Clone BO01488 Report

Search the DGRC for BO01488

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:88
Vector:pDNR-Dual
Associated Gene/Transcriptbap-RA
Protein status:BO01488.pep:
Sequenced Size:1180

Clone Sequence Records

BO01488.3prime Sequence

845 bp (762 high quality bases) assembled on 2005-11-30

> BO01488.3prime
ATGGTCTAGAAAGCTTGCGTCGATCTCCACATTCTCGTCAACATCCTCCG
CCGCCGAGTGAACGCTCTCCGCTCCGCTCTCGACGCTCATCATCTGGCCA
TTGGGACTGGGACACGGCGTTCGCTGGGGACGCACTGCACCCGGGATGGG
GATGGGAACTGGCGATGAGGACGCCGAGGATGCAGTCACAAAGCTGGAAC
TCTGGGTTGGTGGCGGTATGGGTTGCGGCACCTTGTGTTGCGGGTAGAAG
TACGGGAATGGCATCTGCATCTGTGGCAGCGGAAGTCCGCCGTAGGCCAG
CTGCAGCTGATGGCGGTAGATGTTGATCAGGGCGGGATCGAGGCCGTGTC
CAGCACCGGGAGCAGCCATGTGAGCGTAGGTGGTGCTGCCATCCTCTCGC
ACCAAGACTTGGACGGGAACCCTCTTGCTGGCACCCAAAAGGGCGGCCTC
GTGCTGCTGGATCTGCTTGCGCTTGGTCTTGTAGCGGCGGTTTTGGAACC
AGATCTTCACCTGGGTCTCCGTCAGGCGCAGGCTCTTGGCCATCTCGCTG
CGTTCCGGACCGGACAAGTAGCGCTGTTGGGCAAAGCGGCGCTCCAACTC
GAAGACCTGGGCGTGGCTGAAGGCGGCACGCGACCGCTTCTTGCGGCTCA
ATCCACTGCCGTCGTGGGATAGCGGCGACTCCGAGGGGGAACTGCTCAAT
GGCGGTGGTGAGTCGCAGTCGGAATCGTTGCTGGTGCAGCGTCTCATGTC
CAAAGGAGCAGCGAGGGTGGATCCAAAATAGGCCAATTTGCGCTGCATGT
AGTCGGCGGCACTGGAGTTCGATGTGCCCCGTGCCTGGTGATGGT

BO01488.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG7902-PA 1149 bap-RA 320..1146 845..19 4085 99.7 Minus
CG1897-PA 1548 Dr-RA 1372..1415 531..488 145 93.1 Minus
CG6172-PB 1734 vnd-RB 1309..1367 528..470 145 89.8 Minus
CG6172-PA 2172 vnd-RA 1747..1805 528..470 145 89.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
bap-RA 1449 CG7902-RA 455..1281 845..19 4105 99.8 Minus
vnd-RB 3412 CG6172-RB 2147..2205 528..470 205 89.8 Minus
vnd-RA 3033 CG6172-RA 2100..2158 528..470 205 89.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21389580..21390281 720..19 3510 100 Minus
3R 32079331 3R 21389334..21389459 845..720 600 98.4 Minus
X 23542271 X 596886..596944 528..470 205 89.8 Minus
Blast to na_te.dros performed on 2015-02-10 15:40:50 has no hits.

BO01488.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:32 Download gff for BO01488.3prime
Subject Subject Range Query Range Percent Splice Strand
bap-PA 320..1149 18..845 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:05 Download gff for BO01488.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7902-PA 320..1149 18..845 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 02:35:00 Download gff for BO01488.3prime
Subject Subject Range Query Range Percent Splice Strand
bap-RA 455..1287 11..845 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:16:57 Download gff for BO01488.3prime
Subject Subject Range Query Range Percent Splice Strand
bap-RA 455..1287 11..845 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:16:57 Download gff for BO01488.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 21389581..21390287 11..719 99   Minus
3R 21389334..21389459 720..845 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 02:35:00 Download gff for BO01488.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17215303..17216009 11..719 99   Minus
arm_3R 17215056..17215181 720..845 98 -> Minus

BO01488.5prime Sequence

894 bp (765 high quality bases) assembled on 2005-11-30

> BO01488.5prime
GAAGTTATCAGTCGACATGCTGAATATGGAAAGCGCGGGTGTCAGTGCTG
CGATGGCGGGTCTGAGCAAATCGCTCACCACGCCCTTCTCCATCAACGAT
ATCCTAACGCGCAGCAATCCGGAAACACGTCGCATGTCCAGCGTGGACTC
CGAACCGGAACCGGAAAAGCTGAAACCCTCCTCCGATCGCGAGCGATCGA
TCTCCAAGTCGCCGCCACTCTGCTGCCGAGATCTCGGCCTCTACAAGCTG
ACCCAACCCAAGGAGATCCAACCAAGTGCCAGGCAACCCAGCAACTATCT
GCAGTATTATGCGGCGGCGATGGACAACAATAACCACCATCACCAGGCAA
CGGGCACATCGAACTCCAGTGCCGCCGACTACATGCAGCGCAAATTGGCC
TATTTTGGATCCACCCTCGCTGCTCCTTTGGACATGAGACGCTGCACCAG
CAACGATTCCGACTGCGACTCACCACCGCCATTGAGCAGTTCCCCCTCGG
AGTCGCCGCTATCCCACGACGGCAGTGGATTGAGCCGCAAGAAGCGGTCG
CGTGCCGCCTTCAGCCACGCCCAGGTCTTCGAGTTGGAGCGCCGCTTTGC
CCAACAGCGCTACTTGTCCGGTCCGGAACGCAGCGAGATGGCCAAGAGCC
TGCGCCTGACGGAGACCCAGGTGAAGATCTGGTTCCAAAACCGCCGCTAC
AAGACCAAGCGCAAGCAGATCCAGCAGCACGAGGCCGCCCTTTTGGGTGC
CAGCAAGAGGGTTCCCGTCCCAGTCTTGGTGCGAGAGGATGGCAGCACCA
CCTACGCTCACATGGCTGCTCCCGGTGCTGGACACGGCCTCGATCCCGCC
CTGATCCACATCTACCGCCATCAGCTGCAGCTGGCCTACGGCGG

BO01488.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG7902-PA 1149 bap-RA 1..878 17..894 4340 99.7 Plus
CG1897-PA 1548 Dr-RA 1372..1415 650..693 145 93.1 Plus
CG6172-PB 1734 vnd-RB 1309..1367 653..711 145 89.8 Plus
CG6172-PA 2172 vnd-RA 1747..1805 653..711 145 89.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 12:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
bap-RA 1449 CG7902-RA 136..1013 17..894 4360 99.8 Plus
vnd-RB 3412 CG6172-RB 2147..2205 653..711 205 89.8 Plus
vnd-RA 3033 CG6172-RA 2100..2158 653..711 205 89.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 12:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21389015..21389459 17..461 2225 100 Plus
3R 32079331 3R 21389580..21390013 461..894 2140 99.5 Plus
X 23542271 X 596886..596944 653..711 205 89.8 Plus
Blast to na_te.dros performed on 2015-02-13 12:26:52 has no hits.

BO01488.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:33 Download gff for BO01488.5prime
Subject Subject Range Query Range Percent Splice Strand
bap-PA 1..878 17..894 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:06 Download gff for BO01488.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7902-PA 1..878 17..894 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:35:42 Download gff for BO01488.5prime
Subject Subject Range Query Range Percent Splice Strand
bap-RA 136..1013 17..894 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:36:44 Download gff for BO01488.5prime
Subject Subject Range Query Range Percent Splice Strand
bap-RA 136..1013 17..894 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:36:44 Download gff for BO01488.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 21389581..21390013 462..894 99   Plus
3R 21389015..21389459 17..461 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:35:42 Download gff for BO01488.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17215303..17215735 462..894 99   Plus
arm_3R 17214737..17215181 17..461 100 -> Plus

BO01488.complete Sequence

1180 bp (1180 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629518

> BO01488.complete
GAAGTTATCAGTCGACATGCTGAATATGGAAAGCGCGGGTGTCAGTGCTG
CGATGGCGGGTCTGAGCAAATCGCTCACCACGCCCTTCTCCATCAACGAT
ATCCTAACGCGCAGCAATCCGGAAACACGTCGCATGTCCAGCGTGGACTC
CGAACCGGAACCGGAAAAGCTGAAACCCTCCTCCGATCGCGAGCGATCGA
TCTCCAAGTCGCCGCCACTCTGCTGCCGAGATCTCGGCCTCTACAAGCTG
ACCCAACCCAAGGAGATCCAACCAAGTGCCAGGCAACCCAGCAACTATCT
GCAGTATTATGCGGCGGCGATGGACAACAATAACCACCATCACCAGGCAA
CGGGCACATCGAACTCCAGTGCCGCCGACTACATGCAGCGCAAATTGGCC
TATTTTGGATCCACCCTCGCTGCTCCTTTGGACATGAGACGCTGCACCAG
CAACGATTCCGACTGCGACTCACCACCGCCATTGAGCAGTTCCCCCTCGG
AGTCGCCGCTATCCCACGACGGCAGTGGATTGAGCCGCAAGAAGCGGTCG
CGTGCCGCCTTCAGCCACGCCCAGGTCTTCGAGTTGGAGCGCCGCTTTGC
CCAACAGCGCTACTTGTCCGGTCCGGAACGCAGCGAGATGGCCAAGAGCC
TGCGCCTGACGGAGACCCAGGTGAAGATCTGGTTCCAAAACCGCCGCTAC
AAGACCAAGCGCAAGCAGATCCAGCAGCACGAGGCCGCCCTTTTGGGTGC
CAGCAAGAGGGTTCCCGTCCAAGTCTTGGTGCGAGAGGATGGCAGCACCA
CCTACGCTCACATGGCTGCTCCCGGTGCTGGACACGGCCTCGATCCCGCC
CTGATCAACATCTACCGCCATCAGCTGCAGCTGGCCTACGGCGGACTTCC
GCTGCCACAGATGCAGATGCCATTCCCGTACTTCTACCCGCAACACAAGG
TGCCGCAACCCATACCGCCACCAACCCAGAGTTCCAGCTTTGTGACTGCA
TCCTCGGCGTCCTCATCGCCAGTTCCCATCCCCATCCCGGGTGCAGTGCG
TCCCCAGCGAACGCCGTGTCCCAGTCCCAATGGCCAGATGATGAGCGTCG
AGAGCGGAGCGGAGAGCGTTCACTCGGCGGCGGAGGATGTTGACGAGAAT
GTGGAGATCGACGCAAGCTTTCTAGACCAT

BO01488.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
bap-RA 1149 CG7902-PA 1..1146 17..1162 5730 100 Plus
vnd-RB 1734 CG6172-PB 1309..1367 653..711 205 89.8 Plus
vnd-RA 2172 CG6172-PA 1747..1805 653..711 205 89.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
bap-RA 1449 CG7902-RA 136..1281 17..1162 5730 100 Plus
vnd-RB 3412 CG6172-RB 2147..2205 653..711 205 89.8 Plus
vnd-RA 3033 CG6172-RA 2100..2158 653..711 205 89.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21389580..21390281 461..1162 3510 100 Plus
3R 32079331 3R 21389015..21389459 17..461 2225 100 Plus
X 23542271 X 596886..596944 653..711 205 89.8 Plus
Blast to na_te.dros performed on 2014-11-27 14:34:08 has no hits.

BO01488.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:51 Download gff for BO01488.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 1..1149 17..1163 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:31 Download gff for BO01488.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 133..1284 17..1170 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:42:35 Download gff for BO01488.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 136..1281 17..1164 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:51 Download gff for BO01488.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 133..1284 17..1170 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:48:17 Download gff for BO01488.complete
Subject Subject Range Query Range Percent Splice Strand
bap-RA 136..1281 17..1164 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:48:17 Download gff for BO01488.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21389581..21390281 462..1164 99   Plus
3R 21389015..21389459 17..461 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:42:35 Download gff for BO01488.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17215303..17216003 462..1164 99   Plus
arm_3R 17214737..17215181 17..461 100 -> Plus

BO01488.pep Sequence

Translation from 16 to 1180

> BO01488.pep
MLNMESAGVSAAMAGLSKSLTTPFSINDILTRSNPETRRMSSVDSEPEPE
KLKPSSDRERSISKSPPLCCRDLGLYKLTQPKEIQPSARQPSNYLQYYAA
AMDNNNHHHQATGTSNSSAADYMQRKLAYFGSTLAAPLDMRRCTSNDSDC
DSPPPLSSSPSESPLSHDGSGLSRKKRSRAAFSHAQVFELERRFAQQRYL
SGPERSEMAKSLRLTETQVKIWFQNRRYKTKRKQIQQHEAALLGASKRVP
VQVLVREDGSTTYAHMAAPGAGHGLDPALINIYRHQLQLAYGGLPLPQMQ
MPFPYFYPQHKVPQPIPPPTQSSSFVTASSASSSPVPIPIPGAVRPQRTP
CPSPNGQMMSVESGAESVHSAAEDVDENVEIDASFLDH

BO01488.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
bap-PA 382 CG7902-PA 1..382 1..382 1985 100 Plus
Hmx-PD 718 CG43748-PD 319..623 41..318 244 29.4 Plus
scro-PA 468 CG17594-PA 113..358 21..274 239 30.8 Plus
Hmx-PE 592 CG43748-PE 319..558 41..261 239 31.6 Plus
Hmx-PC 592 CG43748-PC 319..558 41..261 239 31.6 Plus