Clone BO01492 Report

Search the DGRC for BO01492

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:14
Well:92
Vector:pDNR-Dual
Associated Gene/TranscriptCG3919-RB
Protein status:BO01492.pep: full length peptide match
Sequenced Size:1210

Clone Sequence Records

BO01492.3prime Sequence

834 bp (800 high quality bases) assembled on 2005-11-30

> BO01492.3prime
ATGGTCTAGAAAGCTTGCCAAATCTTTGGATGCCTTGGACACCAGCTTTG
GCAGCTGCAGCATAAGTCCCATGTGCTGTAGTGGATTCGCCGAGGAGAGA
CTCGAGGTAGTGGATAGCGTTCCATTGACATTCTCCCTGGGATGCGGCTG
CGCTGGGTGGGTTGATGAGGCTGACTGCTCGGAATGGAATATCTCGCCAA
GCAGGTCGTACACACGTCGCTTGAAGTACAGCTTCTGGTGGAAGTTCATG
TGCTTGATTTCGGGACGCAGTCCCTGCAGGAATGCGTCATCGAAATCCAT
GATTGGCAATGCTTCAATACAGCGGGTTGATGTCTTGGCCTCCTTCTCAC
TGCTGTCGCTCTCTGTGCGCATTTCTGCCGGGACCGTGTCCTCGAAATCC
ATGATTGATGATGGTTCATTATTAAATTGTGTTGCCTCAACGTCCGTCGC
CGATGCAGGGTCGGTGCTGTGACGGCTCTGCGCATGCTCCGAATTCAGAA
AGCTCGGGGAGTGCACCATCTCGAGGATTGCCTCTACGGGAGTTTCGGGA
TCCCCTTCGTCGTGCTCCTCCTGTCCCTTGGGTCTTGACCTACGACCTCT
GAGCGGAACGGGCACTCCGGGAGTGATGTGCTTTTGCAGGAACTTCAGCT
CGCTGTTAAGATAGTACGTATTCGCACCGTGATGCAACTTTATTGAGCGG
GCATAGCTGGAGCGAATGTTGCGCCAACGTTCCTTGCAGCTTTTAACCGA
ATTTCGCATCTCATTGGATATTTCCTTCCACGCATTTTTCACAGTCGATT
TCCNGCAGTAGTTGTCATCGTGACGATCGTAAAG

BO01492.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG3919-PA 1179 CG3919-RA 392..1176 803..19 3925 100 Minus
CG3919-PA 1179 CG3919-RA 361..388 834..807 140 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG3919-RB 1358 CG3919-RB 381..1196 834..19 4035 99.8 Minus
CG3919-RC 1406 CG3919-RC 381..881 834..334 2460 99.6 Minus
CG3919-RC 1406 CG3919-RC 925..1244 338..19 1585 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:51:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14412254..14412570 335..19 1585 100 Minus
3L 28110227 3L 14411495..14411811 751..435 1570 99.7 Minus
3L 28110227 3L 14412033..14412136 437..334 520 100 Minus
3L 28110227 3L 14411185..14411272 834..747 399 96.6 Minus
Blast to na_te.dros performed on 2015-02-12 05:51:09 has no hits.

BO01492.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:39 Download gff for BO01492.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3919-PA 361..1179 18..834 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:16 Download gff for BO01492.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3919-PA 361..1179 18..834 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:18:27 Download gff for BO01492.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 381..1202 11..834 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:59:26 Download gff for BO01492.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 381..1202 11..834 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:59:26 Download gff for BO01492.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 14412256..14412576 11..333 99   Minus
3L 14412035..14412136 334..435 100 -> Minus
3L 14411500..14411810 436..746 100 -> Minus
3L 14411185..14411272 747..834 97 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:18:27 Download gff for BO01492.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14405356..14405676 11..333 99   Minus
arm_3L 14405135..14405236 334..435 100 -> Minus
arm_3L 14404600..14404910 436..746 100 -> Minus
arm_3L 14404285..14404372 747..834 97 -> Minus

BO01492.5prime Sequence

868 bp (730 high quality bases) assembled on 2005-11-30

> BO01492.5prime
GAAGTTATCAGTCGACATGTGCTTTAAAATCAAGAACAATTGCTATTTGA
AATTGCAACATTCATTTACAACTGCATCACTTGTTGGCAGCAGCACGAAA
TCGCAGTGTTCAAAGTTGCTAAACACTTGTAATAGCAGCAACTCCGGCGT
CCACGCCAACAACTGCCGCGTGCACGGAAGCAACGAGCGGCTTGAGCCCG
AACTTAATAAGCCAAAACTCGTGATAAAAGCACTGACATCGATTAATTGG
AGCATTTTTAAACCTAATTCACTTTTTATATATGAAATGAATACACGCCG
TCGGTCCATAGCTCCACCACCGAACGTTTACGCCATCAATGCCAAAATAT
GTCATTTGGTGAAACTACATCCTTGTCTTTACGATCGTCACGATGACAAC
TACTTGCGGAAATCGACTGTGAAAAATGCGTGGAAGGAAATATCCAATGA
GATGCGAAATTCGGTTAAAAGCTGCAAGGAACGTTGGCGCAACATTCGCT
CCAGCTATGCCCGCTCAATAAAGTTGCATCACGGTGCGAATACGTACTAT
CTTAACAGCGAGCTGAAGTTCCTGCAAAAGCACATCACTCCCGGAGTGCC
CGTTCCGCTCAGAGGTCGTAGGTCAAGACCCAAGGGACAGGAGGAGCACG
ACGAAGGGGATCCCGAAACTCCCGTAGAGGCAATCCTCGAGATGGTGCAC
TCCCCGAGCTTTCTGAATTCGGAGCATGCGCAGAGCCGTCACAGCACCGA
CCCTGCATCGGCGACGGACGTTGAGGCAACACAATTTAATAATGAACCAT
CATCAATCATGGATTTCGAGGACACGGTCCCGGCAGAAATGCGCACAGAG
AGCGACAGCAGTGAGAAG

BO01492.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG3919-PA 1179 CG3919-RA 1..852 17..868 4260 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG3919-RC 1406 CG3919-RC 20..872 16..868 4265 100 Plus
CG3919-RB 1358 CG3919-RB 20..872 16..868 4265 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14411495..14411811 460..776 1570 99.7 Plus
3L 28110227 3L 14410645..14410901 16..272 1285 100 Plus
3L 28110227 3L 14411081..14411272 273..464 960 100 Plus
3L 28110227 3L 14412033..14412127 774..868 475 100 Plus
Blast to na_te.dros performed 2015-02-10 15:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
rover 7318 rover ROVER 7318bp 6822..6909 17..99 131 66.3 Plus

BO01492.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:40 Download gff for BO01492.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3919-PA 1..852 17..868 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:17 Download gff for BO01492.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3919-PA 1..852 17..868 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 02:35:03 Download gff for BO01492.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 14..872 10..868 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:17:04 Download gff for BO01492.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 14..872 10..868 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:17:04 Download gff for BO01492.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 14412035..14412127 776..868 100   Plus
3L 14411500..14411810 465..775 100 -> Plus
3L 14411081..14411272 273..464 100 -> Plus
3L 14410639..14410901 10..272 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 02:35:03 Download gff for BO01492.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14405135..14405227 776..868 100   Plus
arm_3L 14404600..14404910 465..775 100 -> Plus
arm_3L 14404181..14404372 273..464 100 -> Plus
arm_3L 14403739..14404001 10..272 98 -> Plus

BO01492.complete Sequence

1210 bp (1210 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629520

> BO01492.complete
GAAGTTATCAGTCGACATGTGCTTTAAAATCAAGAACAATTGCTATTTGA
AATTGCAACATTCATTTACAACTGCATCACTTGTTGGCAGCAGCACGAAA
TCGCAGTGTTCAAAGTTGCTAAACACTTGTAATAGCAGCAACTCCGGCGT
CCACGCCAACAACTGCCGCGTGCACGGAAGCAACGAGCGGCTTGAGCCCG
AACTTAATAAGCCAAAACTCGTGATAAAAGCACTGACATCGATTAATTGG
AGCATTTTTAAACCTAATTCACTTTTTATATATGAAATGAATACACGCCG
TCGGTCCATAGCTCCACCACCGAACGTTTACGCCATCAATGCCAAAATAT
GTCATTTGGTGAAACTACATCCTTGTCTTTACGATCGTCACGATGACAAC
TACTTGCGGAAATCGACTGTGAAAAATGCGTGGAAGGAAATATCCAATGA
GATGCGAAATTCGGTTAAAAGCTGCAAGGAACGTTGGCGCAACATTCGCT
CCAGCTATGCCCGCTCAATAAAGTTGCATCACGGTGCGAATACGTACTAT
CTTAACAGCGAGCTGAAGTTCCTGCAAAAGCACATCACTCCCGGAGTGCC
CGTTCCGCTCAGAGGTCGTAGGTCAAGACCCAAGGGACAGGAGGAGCACG
ACGAAGGGGATCCCGAAACTCCCGTAGAGGCAATCCTCGAGATGGTGCAC
TCCCCGAGCTTTCTGAATTCGGAGCATGCGCAGAGCCGTCACAGCACCGA
CCCTGCATCGGCGACGGACGTTGAGGCAACACAATTTAATAATGAACCAT
CATCAATCATGGATTTCGAGGACACGGTCCCGGCAGAAATGCGCACAGAG
AGCGACAGCAGTGAGAAGGAGGCCAAGACATCAACCCGCTGTATTGAAGC
ATTGCCAATCATGGATTTCGATGACGCATTCCTGCAGGGACTGCGTCCCG
AAATCAAGCACATGAACTTCCACCAGAAGCTGTACTTCAAGCGACGTGTG
TACGACCTGCTTGGCGAGATATTCCATTCCGAGCAGTCAGCCTCATCAAC
CCACCCAGCGCAGCCGCATCCCAGGGAGAATGTCAATGGAACGCTATCCA
CTACCTCGAGTCTCTCCTCGGCGAATCCACTACAGCACATGGGACTTATG
CTGCAGCTGCCAAAGCTGGTGTCCAAGGCATCCAAAGATTTGGCAAGCTT
TCTAGACCAT

BO01492.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG3919-RB 909 CG3919-PB 1..906 287..1192 4530 100 Plus
CG3919-RC 957 CG3919-PC 1..591 287..877 2955 100 Plus
CG3919-RC 957 CG3919-PC 635..954 873..1192 1585 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG3919-RB 1358 CG3919-RB 20..1196 16..1192 5885 100 Plus
CG3919-RC 1406 CG3919-RC 20..881 16..877 4310 100 Plus
CG3919-RC 1406 CG3919-RC 925..1244 873..1192 1585 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14412254..14412570 876..1192 1585 100 Plus
3L 28110227 3L 14411495..14411811 460..776 1570 99.7 Plus
3L 28110227 3L 14410645..14410901 16..272 1285 100 Plus
3L 28110227 3L 14411081..14411272 273..464 960 100 Plus
3L 28110227 3L 14412033..14412136 774..877 520 100 Plus
Blast to na_te.dros performed 2014-11-27 02:07:24
Subject Length Description Subject Range Query Range Score Percent Strand
rover 7318 rover ROVER 7318bp 6822..6909 17..99 131 66.3 Plus

BO01492.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:53 Download gff for BO01492.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 1..909 287..1193 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:34 Download gff for BO01492.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 14..1202 10..1200 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:09:57 Download gff for BO01492.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 21..1196 17..1194 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:53 Download gff for BO01492.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 14..1202 10..1200 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:37:52 Download gff for BO01492.complete
Subject Subject Range Query Range Percent Splice Strand
CG3919-RB 21..1196 17..1194 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:37:52 Download gff for BO01492.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14412256..14412570 878..1194 99   Plus
3L 14412035..14412136 776..877 100 -> Plus
3L 14411500..14411810 465..775 100 -> Plus
3L 14411081..14411272 273..464 100 -> Plus
3L 14410646..14410901 17..272 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:09:57 Download gff for BO01492.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14405356..14405670 878..1194 99   Plus
arm_3L 14405135..14405236 776..877 100 -> Plus
arm_3L 14404600..14404910 465..775 100 -> Plus
arm_3L 14404181..14404372 273..464 100 -> Plus
arm_3L 14403746..14404001 17..272 100 -> Plus

BO01492.pep Sequence

Translation from 16 to 1210

> BO01492.pep
MCFKIKNNCYLKLQHSFTTASLVGSSTKSQCSKLLNTCNSSNSGVHANNC
RVHGSNERLEPELNKPKLVIKALTSINWSIFKPNSLFIYEMNTRRRSIAP
PPNVYAINAKICHLVKLHPCLYDRHDDNYLRKSTVKNAWKEISNEMRNSV
KSCKERWRNIRSSYARSIKLHHGANTYYLNSELKFLQKHITPGVPVPLRG
RRSRPKGQEEHDEGDPETPVEAILEMVHSPSFLNSEHAQSRHSTDPASAT
DVEATQFNNEPSSIMDFEDTVPAEMRTESDSSEKEAKTSTRCIEALPIMD
FDDAFLQGLRPEIKHMNFHQKLYFKRRVYDLLGEIFHSEQSASSTHPAQP
HPRENVNGTLSTTSSLSSANPLQHMGLMLQLPKLVSKASKDLASFLDH

BO01492.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:38:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG3919-PB 302 CG3919-PB 1..302 91..392 1591 100 Plus
CG3919-PC 318 CG3919-PC 1..318 91..392 1564 95 Plus
CG4404-PA 308 CG4404-PA 15..98 108..186 178 38.1 Plus
CG3838-PB 435 CG3838-PB 58..140 108..186 165 41 Plus
CG3838-PA 435 CG3838-PA 58..140 108..186 165 41 Plus