Clone BO01502 Report

Search the DGRC for BO01502

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:15
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG7818-RA
Protein status:BO01502.pep: full length peptide match
Sequenced Size:1225

Clone Sequence Records

BO01502.3prime Sequence

843 bp (841 high quality bases) assembled on 2005-11-30

> BO01502.3prime
ATGGTCTAGAAAGCTTGCTCTGGGCCTTCCACGACCACGTGGAAAGCCGC
GTCCTCTTCCTCTTAAAACTTTGCTATTCGGCGGCGGACTCTTGGGCCTC
AGTAGTTCAATCCTACTAGTGCAACCGGTGGCTGGAGCCTCAGCAAAGTA
GGTCTGGTATAGCTCGGAGTTGAAGTTCGAGTTCGTCAGTTCCGGACCAA
CAGTTAGCCAACCTGGTCGAATACTCGAATCTCTGCCGAACAGATGCAAA
CGCCGTCGACCCAAGCAGAAATGTTCGATGATGTGAAAGATCTCGATGGG
CTTCTCGAAGCTGCCAAACTCCTCTTCCTCTGAGATGATTAAATCAATGT
CCACGTTGGCATGGATAAAATCGCCATCAGTGGAGCGGCGAACAGTTCCT
TTGATTCCCATCAGGCAGTGTTCCTTGGTGCGTTGAAAGACCGCTTTCGG
TTCAAGTTGCTTGGAGTGCCCGGGCTTGTTAATGTTGGTCCGTATCCAAC
ATATGTCTTCGCACCTCCGGAATCCCCACTTCTTCAGGCAGTTGCGGCCC
ATGTCCAAGCCCTCCGAGGATCCGCACCAAAGGAATACAAACGAACGATG
AGCAGCTATCTCGCCCACATCCAAATTAAGTATATCATCCCAGTTCCAGA
AAACCCGCGGTGCCCCACCTACAGTGGCTACAGAAGGTGCTGCCCTGGCA
TATTCCTCTAGCGGCGGCTCAATCAAAATAACATCAAACTTGGCGCCCAG
CGTCTTGACATCTAGCGATTTCAGATCCGCCCTTTAGTACATAGGTGCGG
ATGCGGTGTCTTGGATGAGTTTGTCCTTCAGTTTGATCAGTTC

BO01502.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG7818-PA 1194 CG7818-RA 367..1191 843..19 4075 99.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7818-RA 1407 CG7818-RA 484..1308 843..19 4095 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8309255..8309862 626..19 3040 100 Minus
2L 23513712 2L 8308982..8309198 843..627 1055 99.1 Minus
Blast to na_te.dros performed on 2015-02-11 15:42:22 has no hits.

BO01502.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:48 Download gff for BO01502.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7818-PA 367..1194 15..843 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:32 Download gff for BO01502.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7818-PA 367..1194 15..843 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:48:12 Download gff for BO01502.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 484..1318 10..843 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:13:51 Download gff for BO01502.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 484..1318 10..843 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:13:51 Download gff for BO01502.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 8309255..8309872 10..626 99   Minus
2L 8308982..8309198 627..843 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:48:12 Download gff for BO01502.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8309255..8309872 10..626 99   Minus
arm_2L 8308982..8309198 627..843 99 -> Minus

BO01502.5prime Sequence

871 bp (695 high quality bases) assembled on 2005-11-30

> BO01502.5prime
GAAGTTATCAGTCGACATGAGCGATGTGCTAAAGAGCTCCCAGGAGCGAT
CCCGCAAGCGTCGTTTGCTTTTAGCGCAAACTTTGGGCTTGTCGAGCGTC
GACGATCTGAAAAAGGCTTTGGGTAATGCCGAAGACATTAACAGTAGTCG
CCAGCTGAATTCCGGTGGGCAACGCGAGGAGGAGGATGGTGGCGCCTCTT
CCTCCAAGAAAACCCCCAATGAAATCATCTATAGGGACTCCTCGACCTTC
CTGAAGGGAACCCAGTCTTCCAATCCGCACAATGACTACTGCCAGCACTT
TGTGGACACCGGTCAGCGTCCCCAGAACTTCATCCGTGATGTCGGCCTAG
CTGACCGCTTCGAGGAGTATCCCAAGTTGAGGGAACTGATCAAACTGAAG
GACAAACTCATCCAAGACACCGCATCCGCACCTATGTACTTAAAGGCGGA
TCTGAAATCGCTAGATGTCAAGACGCTGGGCGCCAAGTTTGATGTTATTT
TGATTGAGCCGCCGCTAGAGGAATATGCCAGGGCAGCACCTTCTGTAGCC
ACTGTAGGTGGGGCACCGCGGGTTTTCTGGAACTGGGATGATATACTTAA
TTTGGATGTGGGCGAGATAGCTGCTCATCGTTCGTTTGTATTCCTTTGGT
GCGGATCCTCGGAGGGCTTGGACATGGGCCGCAACTGCCTGAAGAAGTGG
GGATTCGGGAGGTGCGAAGACATATGTTGGATACGGACCAACATTAAACA
GCCCGGGCACTCCCAGCAACTTGAACCGAAAGCGGTCTTTTCACGCACCC
AGGAACACTGCCTGATGGGGATCAAAGGAACTGTTCGCCGCTCCACTGAT
GGCGATTTTATCCTGCCCAAC

BO01502.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG7818-PA 1194 CG7818-RA 1..847 17..863 4035 99 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 18:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG7818-RA 1407 CG7818-RA 118..964 17..863 4115 99.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 18:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8308682..8309198 83..599 2585 100 Plus
2L 23513712 2L 8309255..8309518 600..863 1200 97 Plus
2L 23513712 2L 8308544..8308609 17..82 330 100 Plus
Blast to na_te.dros performed on 2015-02-09 18:18:43 has no hits.

BO01502.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:49 Download gff for BO01502.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7818-PA 1..855 17..871 98   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:34 Download gff for BO01502.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7818-PA 1..855 17..871 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 03:54:51 Download gff for BO01502.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 118..972 17..871 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 21:09:53 Download gff for BO01502.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 118..972 17..871 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 21:09:53 Download gff for BO01502.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 8309255..8309526 600..871 96   Plus
2L 8308682..8309198 83..599 100 -> Plus
2L 8308544..8308609 17..82 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 03:54:51 Download gff for BO01502.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8309255..8309526 600..871 96   Plus
arm_2L 8308682..8309198 83..599 100 -> Plus
arm_2L 8308544..8308609 17..82 100 -> Plus

BO01502.complete Sequence

1225 bp (1225 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629522

> BO01502.complete
GAAGTTATCAGTCGACATGAGCGATGTGCTAAAGAGCTCCCAGGAGCGAT
CCCGCAAGCGTCGTTTGCTTTTAGCGCAAACTTTGGGCTTGTCGAGCGTC
GACGATCTGAAAAAGGCTTTGGGTAATGCCGAAGACATTAACAGTAGTCG
CCAGCTGAATTCCGGTGGGCAACGCGAGGAGGAGGATGGTGGCGCCTCTT
CCTCCAAGAAAACCCCCAATGAAATCATCTATAGGGACTCCTCGACCTTC
CTGAAGGGAACCCAGTCTTCCAATCCGCACAATGACTACTGCCAGCACTT
TGTGGACACCGGTCAGCGTCCCCAGAACTTCATCCGTGATGTCGGCCTAG
CTGACCGCTTCGAGGAGTATCCCAAGTTGAGGGAACTGATCAAACTGAAG
GACAAACTCATCCAAGACACCGCATCCGCACCTATGTACTTAAAGGCGGA
TCTGAAATCGCTAGATGTCAAGACGCTGGGCGCCAAGTTTGATGTTATTT
TGATTGAGCCGCCGCTAGAGGAATATGCCAGGGCAGCACCTTCTGTAGCC
ACTGTAGGTGGGGCACCGCGGGTTTTCTGGAACTGGGATGATATACTTAA
TTTGGATGTGGGCGAGATAGCTGCTCATCGTTCGTTTGTATTCCTTTGGT
GCGGATCCTCGGAGGGCTTGGACATGGGCCGCAACTGCCTGAAGAAGTGG
GGATTCCGGAGGTGCGAAGACATATGTTGGATACGGACCAACATTAACAA
GCCCGGGCACTCCAAGCAACTTGAACCGAAAGCGGTCTTTCAACGCACCA
AGGAACACTGCCTGATGGGAATCAAAGGAACTGTTCGCCGCTCCACTGAT
GGCGATTTTATCCATGCCAACGTGGACATTGATTTAATCATCTCAGAGGA
AGAGGAGTTTGGCAGCTTCGAGAAGCCCATCGAGATCTTTCACATCATCG
AACATTTCTGCTTGGGTCGACGGCGTTTGCATCTGTTCGGCAGAGATTCG
AGTATTCGACCAGGTTGGCTAACTGTTGGTCCGGAACTGACGAACTCGAA
CTTCAACTCCGAGCTATACCAGACCTACTTTGCTGAGGCTCCAGCCACCG
GTTGCACTAGTAGGATTGAACTACTGAGGCCCAAGAGTCCGCCGCCGAAT
AGCAAAGTTTTAAGAGGAAGAGGACGCGGCTTTCCACGTGGTCGTGGAAG
GCCCAGAGCAAGCTTTCTAGACCAT

BO01502.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG7818-RA 1194 CG7818-PA 1..1191 17..1207 5955 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG7818-RA 1407 CG7818-RA 118..1308 17..1207 5955 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8309255..8309862 600..1207 3040 100 Plus
2L 23513712 2L 8308682..8309198 83..599 2585 100 Plus
2L 23513712 2L 8308544..8308609 17..82 330 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:45:25 has no hits.

BO01502.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:40 Download gff for BO01502.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 1..1194 17..1211 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:20 Download gff for BO01502.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 105..1305 17..1216 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:58:55 Download gff for BO01502.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 118..1308 17..1209 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:40 Download gff for BO01502.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 105..1305 17..1216 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:26:05 Download gff for BO01502.complete
Subject Subject Range Query Range Percent Splice Strand
CG7818-RA 118..1308 17..1209 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:26:05 Download gff for BO01502.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8309255..8309862 600..1209 99   Plus
2L 8308682..8309198 83..599 100 -> Plus
2L 8308544..8308609 17..82 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:58:55 Download gff for BO01502.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8309255..8309862 600..1209 99   Plus
arm_2L 8308682..8309198 83..599 100 -> Plus
arm_2L 8308544..8308609 17..82 100 -> Plus

BO01502.pep Sequence

Translation from 16 to 1225

> BO01502.pep
MSDVLKSSQERSRKRRLLLAQTLGLSSVDDLKKALGNAEDINSSRQLNSG
GQREEEDGGASSSKKTPNEIIYRDSSTFLKGTQSSNPHNDYCQHFVDTGQ
RPQNFIRDVGLADRFEEYPKLRELIKLKDKLIQDTASAPMYLKADLKSLD
VKTLGAKFDVILIEPPLEEYARAAPSVATVGGAPRVFWNWDDILNLDVGE
IAAHRSFVFLWCGSSEGLDMGRNCLKKWGFRRCEDICWIRTNINKPGHSK
QLEPKAVFQRTKEHCLMGIKGTVRRSTDGDFIHANVDIDLIISEEEEFGS
FEKPIEIFHIIEHFCLGRRRLHLFGRDSSIRPGWLTVGPELTNSNFNSEL
YQTYFAEAPATGCTSRIELLRPKSPPPNSKVLRGRGRGFPRGRGRPRASF
LDH

BO01502.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG7818-PA 397 CG7818-PA 1..397 1..397 2097 100 Plus
Ime4-PA 608 CG5933-PA 385..594 135..365 253 29.3 Plus