Clone BO01505 Report

Search the DGRC for BO01505

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:15
Well:5
Vector:pDNR-Dual
Associated Gene/TranscriptCrc-RA
Protein status:BO01505.pep:
Sequenced Size:1252

Clone Sequence Records

BO01505.3prime Sequence

884 bp (791 high quality bases) assembled on 2005-11-30

> BO01505.3prime
ATGGTCTAGAAAGCTTGCCAATTCGTCGTGTTCGCTTTGATCTTTGTCTT
GCTTAGATTCATCATCCTTCTCCTCATCGTCATCATCCTCGTCCTCATCG
TCCTTGTCGGAAGCCTTTTTCGCCTCCTCCTCGTCCTTCTTGCGCTGCAC
CTCATCCTGGGCCTCCTTCATTTTCTTCTCGCCCGCCTGGGTGTTCTTGA
CTTCGGCAGCAGCCTTAGCGGCCAGCTCCACGTCGTCCGTGATCAGGACG
TTGTCGAAGATAGTGCCGGACTTGACCTGCCAGAGATCGAAGCCCAGGGT
GCAGATCTCCTTGCGCAGATACAGCTTGTCGTCGGGCACATACTCGGGAT
TGGCGATCTCGGGATGCTCCCAGGCGCCCTTGTAGTTGGGGTTGTCCAGC
TGCTTTGGCTGCCACTCGCCCTTGAACTCAGGGTTGTCGATCATCGGTGG
CTCCCACTCGCCGTCCATCTCATCGTCCCAATCCTCAGGCTTTGTGGCAT
CTGGGTCGGGAATGTGCTCTGGTTTGTCCCAGTCCTCGGGCTTCTTGTCA
TCGGGATCGGGAATGGTGGCCCTATCGTCCCAGTCTTCGGGCTTGGTGGC
GGTGGGATCCTTGATCTTCTTGGGGGCCAGGAAGTCCCAGTCGTCCTCCA
GGTTGCCAGACTCCACCTTCTCGTTGTCGATGAGCACCTCGTACGTGTTG
TCGGGTCTGACAATCAGCGTGTAGAAGTGGGTGTACACGTCATCTTTGCA
GCGGATGTCTTTGCTGATTAGGTGGTTCTTGCCCTTGTAGCTGAAGATCA
CATGGACCTTCTTGGTGCCGGGTCCGCAGATGTCCGGGCCGAACATGATC
TCGTACGGCGACTCGCCGTGCATGTCGGTCTGGT

BO01505.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG9429-PA 1221 Crc-RA 353..1218 884..19 4330 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
Crc-RB 1677 CG9429-RB 439..1304 884..19 4330 100 Minus
Crc-RA 1430 CG9429-RA 439..1304 884..19 4330 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:24:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9629064..9629616 19..571 2765 100 Plus
3R 32079331 3R 9629707..9630021 570..884 1575 100 Plus
Blast to na_te.dros performed on 2015-02-12 10:24:38 has no hits.

BO01505.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:52 Download gff for BO01505.3prime
Subject Subject Range Query Range Percent Splice Strand
Crc-PA 353..1221 15..884 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:37 Download gff for BO01505.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9429-PA 353..1221 15..884 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:48:56 Download gff for BO01505.3prime
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 439..1308 14..884 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:00:54 Download gff for BO01505.3prime
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 439..1308 14..884 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:00:54 Download gff for BO01505.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 9629708..9630021 571..884 100   Plus
3R 9629060..9629615 14..570 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:48:56 Download gff for BO01505.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5455430..5455743 571..884 100   Plus
arm_3R 5454782..5455337 14..570 99 <- Plus

BO01505.5prime Sequence

630 bp (488 high quality bases) assembled on 2005-11-30

> BO01505.5prime
GAAGTTATCAGTCGACATGATGTGGTGCAAAACAGTGATAGTGTTGCTGG
CGACAGTCGGCTTTATTAGTGCCGAGGTTTATCTGAAGGAGAATTTCGAC
AACGAAAACTGGGAGGATACGTGGATCTACAGCAAACATCCTGGCAAGGA
GTTCGGAAAATTCGTCCTCACCCCCGGTACCTTCTACAACGATGCTGAGG
CCGACAAAGGCATTCAGACCTCTCAGGATGCTCGATTCTACGCGGCCAGC
CGCAAGTTTGATGGCTTCTCCAACGAGGACAAGCCCCTCGTGGTGCAGTT
CTCCGTGAAGCACGAGCAGAATATCGACTGCGGCGGCGGCTATGTGAAGC
TGTTCGACTGCTCCCTCGACCAGACCGACATGCACGGCGAGTCGCCGTAC
GAGATCATGTTCGGCCCGGACATCTGCGGACCCGGCACCAAGAAGGTCCA
TGTGATCTTCAGCTACAAGGGCAAGAACCACCTAATCAGCAAAGACATCC
GCTGCAAAGATGACGTGTACACCCACTTCTACACGCTGATTGTCAGACCC
GACAACACGTACGAGGTGCTCATCGACAACGAGAAGGTGGAGTCTGGGCA
CCTGGAGGACGACTGGGACTTCCTGGCCCC

BO01505.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG9429-PA 1221 Crc-RA 1..614 17..630 3020 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Crc-RB 1677 CG9429-RB 85..700 15..630 3050 99.7 Plus
Crc-RA 1430 CG9429-RA 85..700 15..630 3050 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9629760..9630182 630..208 2085 99.5 Minus
3R 32079331 3R 9630448..9630554 210..104 535 100 Minus
3R 32079331 3R 9630678..9630767 104..15 450 100 Minus
Blast to na_te.dros performed on 2015-02-12 10:25:05 has no hits.

BO01505.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:31:53 Download gff for BO01505.5prime
Subject Subject Range Query Range Percent Splice Strand
Crc-PA 1..614 17..630 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:39 Download gff for BO01505.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9429-PA 1..614 17..630 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:48:59 Download gff for BO01505.5prime
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 78..700 7..630 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:01:53 Download gff for BO01505.5prime
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 78..700 7..630 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:01:53 Download gff for BO01505.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 9630678..9630774 7..104 96   Minus
3R 9630449..9630553 105..209 100 <- Minus
3R 9629760..9630180 210..630 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:48:59 Download gff for BO01505.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5456400..5456496 7..104 96   Minus
arm_3R 5456171..5456275 105..209 100 <- Minus
arm_3R 5455482..5455902 210..630 99 <- Minus

BO01505.complete Sequence

1252 bp (1252 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629524

> BO01505.complete
GAAGTTATCAGTCGACATGATGTGGTGCAAAACAGTGATAGTGTTGCTGG
CGACAGTCGGCTTTATTAGTGCCGAGGTTTATCTGAAGGAGAATTTCGAC
AACGAAAACTGGGAGGATACGTGGATCTACAGCAAACATCCTGGCAAGGA
GTTCGGAAAATTCGTCCTCACCCCCGGTACCTTCTACAACGATGCTGAGG
CCGACAAAGGCATTCAGACCTCTCAGGATGCTCGATTCTACGCGGCCAGC
CGCAAGTTTGATGGCTTCTCCAACGAGGACAAGCCCCTCGTGGTGCAGTT
CTCCGTGAAGCACGAGCAGAATATCGACTGCGGCGGCGGCTATGTGAAGC
TGTTCGACTGCTCCCTCGACCAGACCGACATGCACGGCGAGTCGCCGTAC
GAGATCATGTTCGGCCCGGACATCTGCGGACCCGGCACCAAGAAGGTCCA
TGTGATCTTCAGCTACAAGGGCAAGAACCACCTAATCAGCAAAGACATCC
GCTGCAAAGATGACGTGTACACCCACTTCTACACGCTGATTGTCAGACCC
GACAACACGTACGAGGTGCTCATCGACAACGAGAAGGTGGAGTCTGGCAA
CCTGGAGGACGACTGGGACTTCCTGGCCCCCAAGAAGATCAAGGATCCCA
CCGCCACCAAGCCCGAAGACTGGGACGATAGGGCCACCATTCCCGATCCC
GATGACAAGAAGCCCGAGGACTGGGACAAACCAGAGCACATTCCCGACCC
AGATGCCACAAAGCCTGAGGATTGGGACGATGAGATGGACGGCGAGTGGG
AGCCACCGATGATCGACAACCCTGAGTTCAAGGGCGAGTGGCAGCCAAAG
CAGCTGGACAACCCCAACTACAAGGGCGCCTGGGAGCATCCCGAGATCGC
CAATCCCGAGTATGTGCCCGACGACAAGCTGTATCTGCGCAAGGAGATCT
GCACCCTGGGCTTCGATCTCTGGCAGGTCAAGTCCGGCACTATCTTCGAC
AACGTCCTGATCACGGACGACGTGGAGCTGGCCGCTAAGGCTGCTGCCGA
AGTCAAGAACACCCAGGCGGGCGAGAAGAAAATGAAGGAGGCCCAGGATG
AGGTGCAGCGCAAGAAGGACGAGGAGGAGGCGAAAAAGGCTTCCGACAAG
GACGATGAGGACGAGGATGATGACGATGAGGAGAAGGATGATGAATCTAA
GCAAGACAAAGATCAAAGCGAACACGACGAATTGGCAAGCTTTCTAGACC
AT

BO01505.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
Crc-RB 1221 CG9429-PB 1..1218 17..1234 6090 100 Plus
Crc-RA 1221 CG9429-PA 1..1218 17..1234 6090 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
Crc-RB 1677 CG9429-RB 85..1304 15..1234 6100 100 Plus
Crc-RA 1430 CG9429-RA 85..1304 15..1234 6100 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9629064..9629616 1234..682 2765 100 Minus
3R 32079331 3R 9629707..9630182 683..208 2380 100 Minus
3R 32079331 3R 9630448..9630554 210..104 535 100 Minus
3R 32079331 3R 9630678..9630767 104..15 450 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:34:06 has no hits.

BO01505.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:43 Download gff for BO01505.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 1..1221 17..1238 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:23 Download gff for BO01505.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 112..1342 7..1239 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 13:02:02 Download gff for BO01505.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 87..1304 17..1236 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:44 Download gff for BO01505.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 112..1342 7..1239 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:21:24 Download gff for BO01505.complete
Subject Subject Range Query Range Percent Splice Strand
Crc-RA 87..1304 17..1236 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:21:24 Download gff for BO01505.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9630678..9630765 17..104 100   Minus
3R 9630449..9630553 105..209 100 <- Minus
3R 9629708..9630180 210..682 100 <- Minus
3R 9629062..9629615 683..1236 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 13:02:02 Download gff for BO01505.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5456400..5456487 17..104 100   Minus
arm_3R 5456171..5456275 105..209 100 <- Minus
arm_3R 5455430..5455902 210..682 100 <- Minus
arm_3R 5454784..5455337 683..1236 99 <- Minus

BO01505.pep Sequence

Translation from 16 to 1252

> BO01505.pep
MMWCKTVIVLLATVGFISAEVYLKENFDNENWEDTWIYSKHPGKEFGKFV
LTPGTFYNDAEADKGIQTSQDARFYAASRKFDGFSNEDKPLVVQFSVKHE
QNIDCGGGYVKLFDCSLDQTDMHGESPYEIMFGPDICGPGTKKVHVIFSY
KGKNHLISKDIRCKDDVYTHFYTLIVRPDNTYEVLIDNEKVESGNLEDDW
DFLAPKKIKDPTATKPEDWDDRATIPDPDDKKPEDWDKPEHIPDPDATKP
EDWDDEMDGEWEPPMIDNPEFKGEWQPKQLDNPNYKGAWEHPEIANPEYV
PDDKLYLRKEICTLGFDLWQVKSGTIFDNVLITDDVELAAKAAAEVKNTQ
AGEKKMKEAQDEVQRKKDEEEAKKASDKDDEDEDDDDEEKDDESKQDKDQ
SEHDELASFLDH

BO01505.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:19:34
Subject Length Description Subject Range Query Range Score Percent Strand
Crc-PB 406 CG9429-PB 1..406 1..406 2237 100 Plus
Crc-PA 406 CG9429-PA 1..406 1..406 2237 100 Plus
Cnx99A-PE 604 CG11958-PE 149..551 88..397 570 32.7 Plus
CG1924-PA 570 CG1924-PA 145..437 88..344 564 39.1 Plus
Cnx99A-PD 605 CG11958-PD 149..552 88..397 560 32.8 Plus