Clone BO01508 Report

Search the DGRC for BO01508

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:15
Well:8
Vector:pDNR-Dual
Associated Gene/Transcriptal-RA
Protein status:BO01508.pep: full length peptide match
Sequenced Size:1258

Clone Sequence Records

BO01508.3prime Sequence

903 bp (796 high quality bases) assembled on 2005-11-30

> BO01508.3prime
ATGGTCTAGAAAGCTTGCGCTGACCACATCGTTTCCATGTCCATTCTGAC
GCAACAGTTCCAGTTTCAGTTCGTGCTCTCTCGCCTTCAGACGCAGTGCG
GCAATGGAGGAGGTGCGCCTGTCCTCGGGTGGCGTTGCAGCTCTGGGAGG
TGGCGGCGGAGCCTGATGCGATGGTGGAGGCAGTTGTCGTTGGGGAGAGT
GCGACAAAGTCAGGGCCACCGGGGAAGTCTGGGTGGGCGATAGACTCGAG
GCCTGTTGGGTCAAGGCGATCCCAACCAGATGCTGGGGAGAAAGCTGAGC
AGGCTGGACTCCAACTGGCATTTGAGGAGGCGCCTGAGGTGGCGGGGGGT
GAGCGGTTGGATGTTGTTGATGCTGGGAGGCGTGCCCGGAGGCAGGCGAT
GTGGGTGGTGAGGCGAGCATGTGGTTGGGCGAATGCAGATCGGGAGATCC
CACCAGTAGTGCAGGAGGTTTTCCAAGTGGAGTCCCGCGCGGAACGGCCG
TCATATTGGCCAGCAAGGATTGAAATGAGCTCGAGGGAGAGTACATACCA
GCCATTCCATGTGGTAACATATGGGGAGGAGCCCTCTGGAATTGGTTAAA
GTAGCCCGACGGAATCATGGGGGCCGCAGAGAGGTGCGGGTAGCGGAAGG
CGGCAAGGTTCGCGGCATGTTGGGCGTCGAAGGGCTTGCGCAGCTGGAAG
CCCAGGTGAGTGAAGGGATTGGGCGGTAGGGCGGCCCCAACTACCGTCTG
CATGGTGGCGGCGCCGCCGGGCAGGTAGGGATTATACGGATGCGACTGGN
GGCCAACCTTCTCCTGCTTGCGCCACTTGGCGCGCCGATTTTGAAACCAA
ACCTGAATGCGCGCCTCGGTTAATCCAATTTTCATCGCCAGCTCCTCTCT
CGT

BO01508.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG3935-PA 1227 al-RA 340..1224 903..19 4406 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
al-RA 1806 CG3935-RA 750..1634 903..19 4414 99.9 Minus
Pph13-RA 1880 CG2819-RA 626..717 899..808 190 80.4 Minus
CG32532-RD 4278 CG32532-RD 2709..2768 868..809 180 86.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:14:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 386701..387267 585..19 2835 100 Minus
2L 23513712 2L 386305..386577 855..583 1354 99.6 Minus
2L 23513712 2L 385699..385748 900..851 250 100 Minus
2L 23513712 2L 578232..578323 899..808 190 80.4 Minus
Blast to na_te.dros performed on 2015-02-13 01:14:13 has no hits.

BO01508.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed on 2007-01-18 01:31:58 has no hits.
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:45 Download gff for BO01508.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3935-PA 340..1227 18..903 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:29:35 Download gff for BO01508.3prime
Subject Subject Range Query Range Percent Splice Strand
al-RA 750..1639 12..903 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:09:06 Download gff for BO01508.3prime
Subject Subject Range Query Range Percent Splice Strand
al-RA 750..1639 12..903 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:09:06 Download gff for BO01508.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 386703..387272 12..583 99   Minus
2L 386308..386576 584..852 99 -> Minus
2L 385697..385746 853..903 96 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:29:35 Download gff for BO01508.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 386703..387272 12..583 99   Minus
arm_2L 386308..386576 584..852 99 -> Minus
arm_2L 385697..385746 853..903 96 -> Minus

BO01508.5prime Sequence

863 bp (832 high quality bases) assembled on 2005-11-30

> BO01508.5prime
GAAGTTATCAGTCGACATGGGCATATCGGAGGAAATCAAGCTGGAGGAAC
TACCGCAAGAAGCCAAGCTAGCGCACCCGGATGCCGTAGTGCTGGTGGAT
CGTGCCCCAGGATCGTCGGCCGCCTCCGCCGGCGCAGCGCTGACGGTTTC
GATGTCGGTCTCGGGCGGAGCGCCCAGTGGAGCAAGTGGGGCCAGTGGCG
GCACCAATAGCCCCGTTTCGGATGGAAACAGCGACTGCGAAGCGGACGAG
TACGCCCCGAAGCGGAAGCAGCGGCGCTATCGCACAACCTTCACCAGCTT
TCAGCTCGAGGAGCTGGAGAAGGCATTCTCGCGGACCCATTATCCCGACG
TGTTTACGAGAGAGGAGCTGGCGATGAAAATTGGATTAACCGAGGCGCGC
ATTCAGGTTTGGTTTCAAAATCGGCGCGCCAAGTGGCGCAAGCAGGAGAA
GGTTGGCCCCCAGTCGCATCCGTATAATCCCTACCTGCCCGGCGGCGCCG
CCACCATGCAGACGGTAGTTGGGGCCGCCCTACCGCCCAATCCCTTCACT
CACCTGGGCTTCCAGCTGCGCAAGCCCTTCGACGCCCAACATGCCGCGAA
CCTTGCCGCCTTCCGCTACCCGCACCTCTCTGCGGCCCCCATGATTCCGT
CGGGCTACTTTAACCAATTCCAGAGGGCTCCTCCCCATATGTTACCACAT
GGAATGGCTGGTATGTACTCTCCCTCGAGCTCATTTCAATCCTTGCTGGC
CAATATGACGGCCGTTCCGCGCGGGACTCCACTTGGAAAACCTCCTGCAC
TACTGGTGGGATCTCCCGATCTGCATTCGCCCAACCACATGCTCGCCTCA
CCACCCACATCGC

BO01508.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG3935-PA 1227 al-RA 1..847 17..863 4235 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:43:01
Subject Length Description Subject Range Query Range Score Percent Strand
al-RA 1806 CG3935-RA 411..1257 17..863 4235 100 Plus
Pph13-RA 1880 CG2819-RA 575..717 309..451 265 79 Plus
CG34340-RF 2989 CG34340-RF 736..916 262..442 260 76.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:42:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 384551..384894 17..360 1720 100 Plus
2L 23513712 2L 386305..386577 404..676 1365 100 Plus
2L 23513712 2L 386701..386890 674..863 950 100 Plus
2L 23513712 2L 578181..578323 309..451 265 79 Plus
2L 23513712 2L 385699..385748 359..408 250 100 Plus
Blast to na_te.dros performed on 2015-02-10 15:42:57 has no hits.

BO01508.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed on 2007-01-18 01:31:59 has no hits.
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:47 Download gff for BO01508.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3935-PA 1..847 17..863 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 02:35:08 Download gff for BO01508.5prime
Subject Subject Range Query Range Percent Splice Strand
al-RA 411..1257 17..863 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:17:12 Download gff for BO01508.5prime
Subject Subject Range Query Range Percent Splice Strand
al-RA 411..1257 17..863 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:17:12 Download gff for BO01508.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 386703..386890 676..863 100   Plus
2L 386308..386576 407..675 100 -> Plus
2L 385701..385746 361..406 100 -> Plus
2L 384551..384894 17..360 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 02:35:08 Download gff for BO01508.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 386703..386890 676..863 100   Plus
arm_2L 386308..386576 407..675 100 -> Plus
arm_2L 385701..385746 361..406 100 -> Plus
arm_2L 384551..384894 17..360 100 -> Plus

BO01508.complete Sequence

1258 bp (1258 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629525

> BO01508.complete
GAAGTTATCAGTCGACATGGGCATATCGGAGGAAATCAAGCTGGAGGAAC
TACCGCAAGAAGCCAAGCTAGCGCACCCGGATGCCGTAGTGCTGGTGGAT
CGTGCCCCAGGATCGTCGGCCGCCTCCGCCGGCGCAGCGCTGACGGTTTC
GATGTCGGTCTCGGGCGGAGCGCCCAGTGGAGCAAGTGGGGCCAGTGGCG
GCACCAATAGCCCCGTTTCGGATGGAAACAGCGACTGCGAAGCGGACGAG
TACGCCCCGAAGCGGAAGCAGCGGCGCTATCGCACAACCTTCACCAGCTT
TCAGCTCGAGGAGCTGGAGAAGGCATTCTCGCGGACCCATTATCCCGACG
TGTTTACGAGAGAGGAGCTGGCGATGAAAATTGGATTAACCGAGGCGCGC
ATTCAGGTTTGGTTTCAAAATCGGCGCGCCAAGTGGCGCAAGCAGGAGAA
GGTTGGCCCCCAGTCGCATCCGTATAATCCCTACCTGCCCGGCGGCGCCG
CCACCATGCAGACGGTAGTTGGGGCCGCCCTACCGCCCAATCCCTTCACT
CACCTGGGCTTCCAGCTGCGCAAGCCCTTCGACGCCCAACATGCCGCGAA
CCTTGCCGCCTTCCGCTACCCGCACCTCTCTGCGGCCCCCATGATTCCGT
CGGGCTACTTTAACCAATTCCAGAGGGCTCCTCCCCATATGTTACCACAT
GGAATGGCTGGTATGTACTCTCCCTCGAGCTCATTTCAATCCTTGCTGGC
CAATATGACGGCCGTTCCGCGCGGGACTCCACTTGGAAAACCTCCTGCAC
TACTGGTGGGATCTCCCGATCTGCATTCGCCCAACCACATGCTCGCCTCA
CCACCCACATCGCCTGCCTCCGGGCACGCCTCCCAGCATCAACAACATCC
AACCGCTCACCCCCCGCCACCTCAGGCGCCTCCTCAAATGCCAGTTGGAG
TCCAGCCTGCTCAGCTTTCTCCCCAGCATCTGGTTGGGATCGCCTTGACC
CAACAGGCCTCGAGTCTATCGCCCACCCAGACTTCCCCGGTGGCCCTGAC
TTTGTCGCACTCTCCCCAACGACAACTGCCTCCACCATCGCATCAGGCTC
CGCCGCCACCTCCCAGAGCTGCAACGCCACCCGAGGACAGGCGCACCTCC
TCCATTGCCGCACTGCGTCTGAAGGCGAGAGAGCACGAACTGAAACTGGA
ACTGTTGCGTCAGAATGGACATGGAAACGATGTGGTCAGCGCAAGCTTTC
TAGACCAT

BO01508.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
al-RA 1227 CG3935-PA 1..1224 17..1240 6120 100 Plus
Pph13-RA 1074 CG2819-PA 68..210 309..451 265 79 Plus
CG34340-RF 1764 CG34340-PF 147..327 262..442 245 75.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
al-RA 1806 CG3935-RA 411..1634 17..1240 6120 100 Plus
Pph13-RA 1880 CG2819-RA 575..717 309..451 265 79 Plus
CG34340-RF 2989 CG34340-RF 736..916 262..442 245 75.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:10:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 386701..387267 674..1240 2835 100 Plus
2L 23513712 2L 384551..384894 17..360 1720 100 Plus
2L 23513712 2L 386305..386577 404..676 1365 100 Plus
2L 23513712 2L 578181..578323 309..451 265 79 Plus
2L 23513712 2L 385699..385748 359..408 250 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:10:25 has no hits.

BO01508.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:07 Download gff for BO01508.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 1..1227 17..1241 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:15:42 Download gff for BO01508.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 407..1635 17..1247 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:19:16 Download gff for BO01508.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 411..1634 17..1242 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:07 Download gff for BO01508.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 407..1635 17..1247 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:27:25 Download gff for BO01508.complete
Subject Subject Range Query Range Percent Splice Strand
al-RA 411..1634 17..1242 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:27:25 Download gff for BO01508.complete
Subject Subject Range Query Range Percent Splice Strand
2L 386703..387267 676..1242 99   Plus
2L 386308..386576 407..675 100 -> Plus
2L 385701..385746 361..406 100 -> Plus
2L 384551..384894 17..360 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:19:16 Download gff for BO01508.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 386703..387267 676..1242 99   Plus
arm_2L 386308..386576 407..675 100 -> Plus
arm_2L 385701..385746 361..406 100 -> Plus
arm_2L 384551..384894 17..360 100 -> Plus

BO01508.pep Sequence

Translation from 16 to 1258

> BO01508.pep
MGISEEIKLEELPQEAKLAHPDAVVLVDRAPGSSAASAGAALTVSMSVSG
GAPSGASGASGGTNSPVSDGNSDCEADEYAPKRKQRRYRTTFTSFQLEEL
EKAFSRTHYPDVFTREELAMKIGLTEARIQVWFQNRRAKWRKQEKVGPQS
HPYNPYLPGGAATMQTVVGAALPPNPFTHLGFQLRKPFDAQHAANLAAFR
YPHLSAAPMIPSGYFNQFQRAPPHMLPHGMAGMYSPSSSFQSLLANMTAV
PRGTPLGKPPALLVGSPDLHSPNHMLASPPTSPASGHASQHQQHPTAHPP
PPQAPPQMPVGVQPAQLSPQHLVGIALTQQASSLSPTQTSPVALTLSHSP
QRQLPPPSHQAPPPPPRAATPPEDRRTSSIAALRLKAREHELKLELLRQN
GHGNDVVSASFLDH

BO01508.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:31:24
Subject Length Description Subject Range Query Range Score Percent Strand
al-PA 408 CG3935-PA 1..408 1..408 2146 100 Plus
Rx-PB 904 CG10052-PB 541..892 67..390 375 33.5 Plus
otp-PK 416 CG10036-PK 69..392 38..335 321 30.3 Plus
otp-PJ 374 CG10036-PJ 69..350 38..335 319 32.3 Plus
hbn-PA 409 CG33152-PA 139..364 71..306 312 35.6 Plus