Clone BO01512 Report

Search the DGRC for BO01512

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:15
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptDoc3-RA
Protein status:BO01512.pep:
Sequenced Size:1306

Clone Sequence Records

BO01512.3prime Sequence

915 bp (816 high quality bases) assembled on 2005-11-30

> BO01512.3prime
ATGGTCTAGAAAGCTTGCAATGGACGAGCTGGTTCCTAATATGTCCGAGA
TGCTGAAGCTGCTGCGCTTCGGCTTGGCCATCGTCGGATCGCTGGATGAC
GAAGCAGGGGCAGTAGCAGTGGCTGGCACAGGCGGAGATGGAGGCGGAGG
AGCAGCCGGTGCGGTTCCAACCACATCTACAAAGGTGTCGGCATCGGCAT
CTGCCTCTCGGTCGGCAGCAGATTCGCCGCTCGTCGAGCCCGCCGAGGAG
GACGAGACAGAGGAGGCCGGCGATGGCGGTGTGTAAGCCCAACTTGGATA
AGCACCACCGATGTGCCTGGCATACTCGATGGCCGGCGGCGGTGGCGCTG
GCACATAGAAATTGGCCTCCAGAGCATCCAGCAGATAGTGACGCTGCATA
GGAACACTGTGATGACTCTGGTGATGATGGTGCTGGGGAAATTCCTCCAC
GAGTCGCAACCGTTTGGCTAACGGCGATGTCACCGGGCTTCGATCCACCT
GGTTTGCCTCGGGCTGCGTTGGCGGTGGCGAGTCATTGATCTTCCGTTTG
CATCTCGACTGACCCGACTCACGGAATCCCTTGGCAAAGGGATTGTTGTC
GATCTTCAGCTTGGTTATGCGGTCATTCTGATAAGCTGTTACGGCTATAA
ACTCCGTCTCCGGAAAGATAAAGGCCTGTTGGGGGGCCCAGGGAATCTGG
CCGAGATCAGAGGTTCGTATGACGTGCAGACGCGGCTGATACTTGTGCAT
GCTGGCCAAGACGATATGACCATTGTTATCCAGCGTATTATTCGTCAATT
TCACTTTGCTGAAGAGCAGAGCCTGGGATTGCCAGTGTTTTCCCGTGGCT
GGACTCTCCGGATGCAGATACATGCGCTGCGGGCTCTGGGGCTCGGCTCC
TCCGGCCGGCACCCC

BO01512.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5093-PA 1275 Doc3-RA 377..1272 914..19 4480 100 Minus
CG5187-PB 1410 Doc2-RB 484..578 798..704 250 90.5 Minus
CG5187-PA 1410 Doc2-RA 484..578 798..704 250 90.5 Minus
CG5133-PA 1176 Doc1-RA 382..440 909..851 245 96.6 Minus
CG5187-PB 1410 Doc2-RB 661..710 621..572 175 94 Minus
CG5187-PA 1410 Doc2-RA 661..710 621..572 175 94 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:44:41
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-RA 1671 CG5093-RA 499..1394 914..19 4480 100 Minus
Doc2-RA 1945 CG5187-RA 723..1098 914..539 890 82.8 Minus
Doc1-RB 1339 CG5133-RB 355..728 914..541 790 80.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9006361..9006972 630..19 3060 100 Minus
3L 28110227 3L 9005894..9006042 914..766 745 100 Minus
3L 28110227 3L 9006159..9006296 765..628 690 100 Minus
3L 28110227 3L 9014492..9014626 628..762 405 86.7 Plus
3L 28110227 3L 9043507..9043642 914..779 380 85.3 Minus
3L 28110227 3L 9013533..9013624 539..630 265 85.9 Plus
3L 28110227 3L 9014716..9014856 774..914 240 78 Plus
3L 28110227 3L 9043724..9043861 765..628 225 77.5 Minus
3L 28110227 3L 9044342..9044431 630..541 210 82.2 Minus
Blast to na_te.dros performed on 2015-02-10 15:44:37 has no hits.

BO01512.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:32:05 Download gff for BO01512.3prime
Subject Subject Range Query Range Percent Splice Strand
Doc3-PA 375..1275 15..915 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:57 Download gff for BO01512.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5093-PA 375..1275 15..915 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-15 02:35:16 Download gff for BO01512.3prime
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 497..1407 6..915 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:17:21 Download gff for BO01512.3prime
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 497..1407 6..915 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:17:21 Download gff for BO01512.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 9006364..9006985 6..627 99   Minus
3L 9006159..9006296 628..765 100 -> Minus
3L 9005892..9006042 766..915 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-15 02:35:16 Download gff for BO01512.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8999464..9000085 6..627 99   Minus
arm_3L 8999259..8999396 628..765 100 -> Minus
arm_3L 8998992..8999142 766..915 99 -> Minus

BO01512.5prime Sequence

799 bp (797 high quality bases) assembled on 2005-11-30

> BO01512.5prime
GAAGTTATCAGTCGACATGTTGACCTTGCCCAACATCGCCGATCTGCGAT
TGCAGCAGCAGATCGCCCAGGAGATATACCGCCAGCAGATTATGCAACGT
TTACCCGATCCCCTATGCGGCCTGCTACCCAACTTTGCCGGACACTTTAT
GCCACCGCCGCCACCGCCGCAACCCACTTTGCCCGGCGATGTGGAGGCCA
AGCTGGAGAATAACGAACTCTGGCAGCAGTTCCACAGCATCGGCACCGAG
ATGATCATCACCAAGTGCGGCAGACGCATGTTCCCTTCGATGCGGGTTTC
CCTCAGTGGACTGGAGGAGGAGGCCAGCTATTGCGTGCTCCTCGAGATGG
TGCCCATTGGCGATTGTCGCTATAAGTTCTCTGGATCCCAGTGGGTGCCG
GCCGGAGGAGCCGAGCCCCAGAGCCCGCAGCGCATGTATCTGCATCCGGA
GAGTCCAGCCACGGGAAAACACTGGCAATCCCAGGCTCTGCTCTTCAGCA
AAGTGAAATTGACGAATAATACGCTGGATAACAATGGTCATATCGTCTTG
GCCAGCATGCACAAGTATCAGCCGCGTCTGCACGTCATACGAACCTCTGA
TCTCGGCCAGATTCCCTGGGCCCCCCAACAGGCCTTTATCTTTCCGGAGA
CGGAGTTTATAGCCGTAACAGCTTATCAGAATGACCGCATAACCAAGCTG
AAGATCGACAACAATCCCTTTGCCAAGGGATTCCGTGAGTCGGGTCAGTC
GAGATGCAAACGGAAGATCAATGACTCGCCACCGCCAACGCAGCCCGAG

BO01512.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG5093-PA 1275 Doc3-RA 1..783 17..799 3915 100 Plus
CG5133-PA 1176 Doc1-RA 223..440 239..456 740 93.5 Plus
CG5187-PB 1410 Doc2-RB 303..437 328..462 275 88.1 Plus
CG5187-PA 1410 Doc2-RA 303..437 328..462 275 88.1 Plus
CG5187-PB 1410 Doc2-RB 484..578 509..603 250 90.5 Plus
CG5187-PA 1410 Doc2-RA 484..578 509..603 250 90.5 Plus
CG5187-PB 1410 Doc2-RB 661..710 686..735 175 94 Plus
CG5187-PA 1410 Doc2-RA 661..710 686..735 175 94 Plus
CG5187-PB 1410 Doc2-RB 226..269 251..294 145 93.1 Plus
CG5187-PA 1410 Doc2-RA 226..269 251..294 145 93.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-RA 1671 CG5093-RA 123..905 17..799 3915 100 Plus
Doc1-RB 1339 CG5133-RB 138..728 173..766 1505 83.7 Plus
Doc1-RA 1526 CG5133-RA 325..915 173..766 1505 83.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 14:51:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9005772..9006042 271..541 1355 100 Plus
3L 28110227 3L 9043385..9043642 271..528 870 89.1 Plus
3L 28110227 3L 9005470..9005636 107..273 835 100 Plus
3L 28110227 3L 9006159..9006296 542..679 690 100 Plus
3L 28110227 3L 9006361..9006483 677..799 615 100 Plus
3L 28110227 3L 9014716..9014937 533..312 495 81.5 Minus
3L 28110227 3L 9005318..9005408 17..107 455 100 Plus
3L 28110227 3L 9014492..9014626 679..545 405 86.7 Minus
3L 28110227 3L 9013533..9013624 768..677 265 85.9 Minus
3L 28110227 3L 9042116..9042196 191..271 240 86.4 Plus
3L 28110227 3L 9043724..9043861 542..679 225 77.5 Plus
3L 28110227 3L 9044342..9044431 677..766 210 82.2 Plus
Blast to na_te.dros performed on 2015-02-13 14:51:14 has no hits.

BO01512.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:32:06 Download gff for BO01512.5prime
Subject Subject Range Query Range Percent Splice Strand
Doc3-PA 1..783 17..799 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:30:58 Download gff for BO01512.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5093-PA 1..783 17..799 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 10:57:42 Download gff for BO01512.5prime
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 123..905 17..799 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:37:23 Download gff for BO01512.5prime
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 123..905 17..799 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:37:23 Download gff for BO01512.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 9006364..9006483 680..799 100   Plus
3L 9006159..9006296 542..679 100 -> Plus
3L 9005775..9006042 274..541 100 -> Plus
3L 9005471..9005636 108..273 100 -> Plus
3L 9005318..9005408 17..107 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 10:57:42 Download gff for BO01512.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8999464..8999583 680..799 100   Plus
arm_3L 8999259..8999396 542..679 100 -> Plus
arm_3L 8998875..8999142 274..541 100 -> Plus
arm_3L 8998571..8998736 108..273 100 -> Plus
arm_3L 8998418..8998508 17..107 100 -> Plus

BO01512.complete Sequence

1306 bp (1306 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629526

> BO01512.complete
GAAGTTATCAGTCGACATGTTGACCTTGCCCAACATCGCCGATCTGCGAT
TGCAGCAGCAGATCGCCCAGGAGATATACCGCCAGCAGATTATGCAACGT
TTACCCGATCCCCTATGCGGCCTGCTACCCAACTTTGCCGGACACTTTAT
GCCACCGCCGCCACCGCCGCAACCCACTTTGCCCGGCGATGTGGAGGCCA
AGCTGGAGAATAACGAACTCTGGCAGCAGTTCCACAGCATCGGCACCGAG
ATGATCATCACCAAGTGCGGCAGACGCATGTTCCCTTCGATGCGGGTTTC
CCTCAGTGGACTGGAGGAGGAGGCCAGCTATTGCGTGCTCCTCGAGATGG
TGCCCATTGGCGATTGTCGCTATAAGTTCTCTGGATCCCAGTGGGTGCCG
GCCGGAGGAGCCGAGCCCCAGAGCCCGCAGCGCATGTATCTGCATCCGGA
GAGTCCAGCCACGGGAAAACACTGGCAATCCCAGGCTCTGCTCTTCAGCA
AAGTGAAATTGACGAATAATACGCTGGATAACAATGGTCATATCGTCTTG
GCCAGCATGCACAAGTATCAGCCGCGTCTGCACGTCATACGAACCTCTGA
TCTCGGCCAGATTCCCTGGGCCCCCCAACAGGCCTTTATCTTTCCGGAGA
CGGAGTTTATAGCCGTAACAGCTTATCAGAATGACCGCATAACCAAGCTG
AAGATCGACAACAATCCCTTTGCCAAGGGATTCCGTGAGTCGGGTCAGTC
GAGATGCAAACGGAAGATCAATGACTCGCCACCGCCAACGCAGCCCGAGG
CAAACCAGGTGGATCGAAGCCCGGTGACATCGCCGTTAGCCAAACGGTTG
CGACTCGTGGAGGAATTTCCCCAGCACCATCATCACCAGAGTCATCACAG
TGTTCCTATGCAGCGTCACTATCTGCTGGATGCTCTGGAGGCCAATTTCT
ATGTGCCAGCGCCACCGCCGCCGGCCATCGAGTATGCCAGGCACATCGGT
GGTGCTTATCCAAGTTGGGCTTACACACCGCCATCGCCGGCCTCCTCTGT
CTCGTCCTCCTCGGCGGGCTCGACGAGCGGCGAATCTGCTGCCGACCGAG
AGGCAGATGCCGATGCCGACACCTTTGTAGATGTGGTTGGAACCGCACCG
GCTGCTCCTCCGCCTCCATCTCCGCCTGTGCCAGCCACTGCTACTGCCCC
TGCTTCGTCATCCAGCGATCCGACGATGGCCAAGCCGAAGCGCAGCAGCT
TCAGCATCTCGGACATATTAGGAACCAGCTCGTCCATTGCAAGCTTTCTA
GACCAT

BO01512.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-RA 1275 CG5093-PA 1..1272 17..1288 6360 100 Plus
Doc1-RB 1071 CG5133-PB 70..645 191..766 1500 84 Plus
Doc1-RA 1176 CG5133-PA 175..750 191..766 1500 84 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-RA 1671 CG5093-RA 123..1394 17..1288 6360 100 Plus
Doc1-RB 1339 CG5133-RB 153..728 191..766 1500 84 Plus
Doc1-RA 1526 CG5133-RA 340..915 191..766 1500 84 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 9006361..9006972 677..1288 3060 100 Plus
3L 28110227 3L 9005772..9006042 271..541 1355 100 Plus
3L 28110227 3L 9043385..9043642 271..528 870 89.1 Plus
3L 28110227 3L 9005470..9005636 107..273 835 100 Plus
3L 28110227 3L 9006159..9006296 542..679 690 100 Plus
3L 28110227 3L 9014716..9014937 533..312 495 81.5 Minus
3L 28110227 3L 9005318..9005408 17..107 455 100 Plus
3L 28110227 3L 9014492..9014626 679..545 405 86.7 Minus
3L 28110227 3L 9013533..9013624 768..677 265 85.9 Minus
3L 28110227 3L 9042116..9042196 191..271 240 86.4 Plus
3L 28110227 3L 9043724..9043861 542..679 225 77.5 Plus
3L 28110227 3L 9044342..9044431 677..766 210 82.2 Plus
Blast to na_te.dros performed on 2014-11-27 10:54:42 has no hits.

BO01512.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:46 Download gff for BO01512.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 1..1275 17..1292 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:25 Download gff for BO01512.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 121..1405 17..1301 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:44:08 Download gff for BO01512.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 128..1394 22..1290 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:47 Download gff for BO01512.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 121..1405 17..1301 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:33:59 Download gff for BO01512.complete
Subject Subject Range Query Range Percent Splice Strand
Doc3-RA 128..1394 22..1290 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:33:59 Download gff for BO01512.complete
Subject Subject Range Query Range Percent Splice Strand
3L 9006364..9006972 680..1290 99   Plus
3L 9006159..9006296 542..679 100 -> Plus
3L 9005775..9006042 274..541 100 -> Plus
3L 9005471..9005636 108..273 100 -> Plus
3L 9005323..9005408 22..107 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:44:08 Download gff for BO01512.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8999464..9000072 680..1290 99   Plus
arm_3L 8999259..8999396 542..679 100 -> Plus
arm_3L 8998875..8999142 274..541 100 -> Plus
arm_3L 8998571..8998736 108..273 100 -> Plus
arm_3L 8998423..8998508 22..107 100 -> Plus

BO01512.pep Sequence

Translation from 16 to 1306

> BO01512.pep
MLTLPNIADLRLQQQIAQEIYRQQIMQRLPDPLCGLLPNFAGHFMPPPPP
PQPTLPGDVEAKLENNELWQQFHSIGTEMIITKCGRRMFPSMRVSLSGLE
EEASYCVLLEMVPIGDCRYKFSGSQWVPAGGAEPQSPQRMYLHPESPATG
KHWQSQALLFSKVKLTNNTLDNNGHIVLASMHKYQPRLHVIRTSDLGQIP
WAPQQAFIFPETEFIAVTAYQNDRITKLKIDNNPFAKGFRESGQSRCKRK
INDSPPPTQPEANQVDRSPVTSPLAKRLRLVEEFPQHHHHQSHHSVPMQR
HYLLDALEANFYVPAPPPPAIEYARHIGGAYPSWAYTPPSPASSVSSSSA
GSTSGESAADREADADADTFVDVVGTAPAAPPPPSPPVPATATAPASSSS
DPTMAKPKRSSFSISDILGTSSSIASFLDH

BO01512.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
Doc3-PA 424 CG5093-PA 1..424 1..424 2256 100 Plus
Doc1-PA 391 CG5133-PA 1..389 1..418 1161 59.4 Plus
Doc2-PA 469 CG5187-PA 1..252 1..255 1065 77.2 Plus
Doc1-PB 356 CG5133-PB 16..354 50..418 1046 60.6 Plus
bi-PE 970 CG3578-PE 319..685 50..400 609 37.6 Plus