Clone BO01514 Report

Search the DGRC for BO01514

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:15
Well:14
Vector:pDNR-Dual
Associated Gene/Transcriptachi-RA
Protein status:BO01514.pep: full length peptide match
Sequenced Size:1312

Clone Sequence Records

BO01514.3prime Sequence

885 bp (804 high quality bases) assembled on 2005-11-30

> BO01514.3prime
ATGGTCTAGAAAGCTTGCGTCTCCCATGTAAACGAAATCGTCATCCTGGA
CGTCATCGTTTTGGCGCACAGCCATGGCAGTTTCCACTAGATAATAGAGA
CACTTGTACTTGGCACGCTCATCTGGACTTGTGCCCTGCGACATAGCAGA
TAATTGACTCTGGCCAGCTTCTGCTTCGGCACCGGTAAACACCTCGTCCG
CCTGTAGATTGTCACCAATGTCCTGTTGATTGGAGTTGGTAGGATCGATT
GTCTGGATTTCTGAGGCCTGTATTCTATTCAGCTCGCTTTCAAAGTCAGT
CAACTGTTGATTCACGTCACGCTTCGCAGTCTGATTGCGATTCCAGATGG
CGGTATTCTGAACAGATCCCTTAGAACCAGAGGTACCTGGATTATTGCCA
GCCGAAGTGCTGACTTCCTCAGTACCAAATACAGTTTTTATAACGCTCTG
CCAATCATGGGAGGTCTCGAAGCGTACTTCCTCCTCGCTGTTCGGCCCAC
AGGACTCGTATCCCTGTGCACTCTCTTCGCCTTCGGACCTGTAGATGACA
CTGTCCTCGTACTCCGGCTCCATCTTGACCATTTGTCCGTTGGGGCCCTG
CACATACTGTTCAAAGTTGGTCAGCACATTGGCGATGCCCTCGTGAATCT
CACCGGCGCCATCCACCTCCTCTGTAGCGCCAACGACCACTTCGGAAGCA
GGACTTCCGTGTGCGGGATTCGGCCCAGTCAAGTTTGCGCCCAACGCACT
TGATCTCGAACAGTTGGGGCTAACCTTTTTGCCACGTCGCGATATGGTGA
AGTGCAGAGGATCGTTGCCCTCGCGCCTGATCATCTCCGGTAGAATGCGG
CGACGGGCATTGATGAACCAGTTGCACACTTGGAG

BO01514.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG8819-PA 1281 achi-RA 412..1278 885..19 4335 100 Minus
CG8821-PA 1275 vis-RA 406..1173 885..118 3615 98.8 Minus
CG8819-PC 1668 achi-RC 1144..1665 540..19 2610 100 Minus
CG8821-PB 1575 vis-RB 1051..1473 540..118 1915 98.1 Minus
CG8819-PC 1668 achi-RC 412..758 885..539 1735 100 Minus
CG8821-PB 1575 vis-RB 516..665 688..539 750 100 Minus
CG8821-PB 1575 vis-RB 406..518 885..773 540 99.1 Minus
CG8821-PA 1275 vis-RA 1179..1272 112..19 470 100 Minus
CG8821-PB 1575 vis-RB 1479..1572 112..19 470 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
achi-RA 2122 CG8819-RA 716..1582 885..19 4335 100 Minus
vis-RA 1741 CG8821-RA 499..1365 885..19 4140 98.5 Minus
achi-RD 2277 CG8819-RD 1216..1737 540..19 2610 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12513566..12513765 686..885 1000 100 Plus
2R 25286936 2R 12509777..12509976 686..885 985 99.5 Plus
2R 25286936 2R 12512254..12512435 134..315 910 100 Plus
2R 25286936 2R 12508465..12508646 134..315 850 97.8 Plus
2R 25286936 2R 12509569..12509720 537..688 760 100 Plus
2R 25286936 2R 12513358..12513509 537..688 760 100 Plus
2R 25286936 2R 12512501..12512622 315..436 610 100 Plus
2R 25286936 2R 12512074..12512190 19..135 585 100 Plus
2R 25286936 2R 12508712..12508833 315..436 580 98.4 Plus
2R 25286936 2R 12508893..12508997 437..541 525 100 Plus
2R 25286936 2R 12512682..12512786 437..541 525 100 Plus
2R 25286936 2R 12508272..12508388 19..135 495 94.9 Plus
Blast to na_te.dros performed on 2015-02-13 01:14:35 has no hits.

BO01514.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:32:09 Download gff for BO01514.3prime
Subject Subject Range Query Range Percent Splice Strand
achi-PA 412..1281 18..885 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:31:02 Download gff for BO01514.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8819-PA 412..1281 18..885 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:29:37 Download gff for BO01514.3prime
Subject Subject Range Query Range Percent Splice Strand
achi-RA 716..1588 13..885 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:10:52 Download gff for BO01514.3prime
Subject Subject Range Query Range Percent Splice Strand
achi-RA 716..1588 13..885 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:10:52 Download gff for BO01514.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 12513568..12513765 688..885 100   Plus
2R 12513360..12513508 539..687 100 <- Plus
2R 12512682..12512783 437..538 100 <- Plus
2R 12512501..12512622 315..436 100 <- Plus
2R 12512255..12512434 135..314 100 <- Plus
2R 12512068..12512189 13..134 97 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:29:37 Download gff for BO01514.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8401073..8401270 688..885 100   Plus
arm_2R 8400865..8401013 539..687 100 <- Plus
arm_2R 8400187..8400288 437..538 100 <- Plus
arm_2R 8400006..8400127 315..436 100 <- Plus
arm_2R 8399760..8399939 135..314 100 <- Plus
arm_2R 8399573..8399694 13..134 97 <- Plus

BO01514.5prime Sequence

812 bp (776 high quality bases) assembled on 2005-11-30

> BO01514.5prime
GAAGTTATCAGTCGACATGATCTCGCCGGAACAAGAAGAGGTCAACATGG
TCCTGGATCGCCATGTACGGCAGAATATCCAGGACATGATGCACGAGGCT
CATGTCCAGGCGAGCCTGCTGGAGAACGAAGGACGCGGCCGTTTCCACTC
GGACTCAAGTTTGGACCAGGATTCTCTTCACGCTGACGTCATCGTGGAGG
AGGATCAGAGCACCGAACACGGCGCCAACCAGGTGCAAAACTACCACGAC
ATGATGGTGGACAGTGAACACCACATCGACATAAATGGGTCGCTGCGCAA
ACGTCGTGGAAATCTTCCCAAGACCTCTGTAAAGATTTTAAAGCGTTGGC
TTTATGAGCACCGCTATAACGCCTATCCGAGCGATGCGGAGAAGTTCACC
CTGTCCCAGGAGGCCAATCTGACGGTGCTCCAAGTGTGCAACTGGTTCAT
CAATGCCCGTCGCCGCATTCTACCGGAGATGATCAGGCGCGAGGGCAACG
ATCCTCTGCACTTCACCATATCGCGACGTGGCAAAAAGGTTAGCCCCAAC
TGTTCGAGATCAAGTGCGTTGGGCGCAAACTTGACTGGGCCGAATCCCGC
ACACGGAAGTCCTGCTTCCGAAGTGGTCGTTGGCGCTACAGAGGAGGTGG
ATGGCGCCGGTGAGATTCACGAGGGCATCGCCAATGTGCTGACCAACTTT
GAACAGTATGTGCAGGGCCCCAACGGACAAATGGTCAAGATGGAGCCGGA
GTACGAGGACAGTGTCATCTACAGGTCCGAAGGCGAAGAGAGTGCACAGG
GATACGAGTCCT

BO01514.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG8819-PA 1281 achi-RA 1..796 17..812 3980 100 Plus
CG8819-PC 1668 achi-RC 1..758 17..774 3790 100 Plus
CG8821-PA 1275 vis-RA 186..790 208..812 2825 98.6 Plus
CG8821-PB 1575 vis-RB 186..518 208..540 1465 97.5 Plus
CG8821-PB 1575 vis-RB 516..665 625..774 750 100 Plus
CG8821-PA 1275 vis-RA 1..167 17..183 510 92.2 Plus
CG8821-PB 1575 vis-RB 1..167 17..183 510 92.2 Plus
CG8819-PC 1668 achi-RC 1144..1183 773..812 200 100 Plus
CG8821-PB 1575 vis-RB 1051..1090 773..812 200 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:51:51
Subject Length Description Subject Range Query Range Score Percent Strand
achi-RA 2122 CG8819-RA 305..1100 17..812 3980 100 Plus
achi-RD 2277 CG8819-RD 73..830 17..774 3790 100 Plus
achi-RC 2509 CG8819-RC 305..1062 17..774 3790 100 Plus
achi-RD 2277 CG8819-RD 1216..1255 773..812 200 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 05:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12513566..12514063 627..130 2490 100 Minus
2R 25286936 2R 12509777..12510268 627..130 2095 95.2 Minus
2R 25286936 2R 12509569..12509720 776..625 760 100 Minus
2R 25286936 2R 12513358..12513509 776..625 760 100 Minus
2R 25286936 2R 12514129..12514244 132..17 580 100 Minus
2R 25286936 2R 12510327..12510439 129..17 445 92.9 Minus
2R 25286936 2R 12508957..12508997 812..772 205 100 Minus
2R 25286936 2R 12512746..12512786 812..772 205 100 Minus
Blast to na_te.dros performed on 2015-02-12 05:51:47 has no hits.

BO01514.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:32:10 Download gff for BO01514.5prime
Subject Subject Range Query Range Percent Splice Strand
achi-PA 1..796 17..812 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-09 23:31:04 Download gff for BO01514.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8819-PA 1..796 17..812 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 05:18:32 Download gff for BO01514.5prime
Subject Subject Range Query Range Percent Splice Strand
achi-RA 305..1100 17..812 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 08:01:28 Download gff for BO01514.5prime
Subject Subject Range Query Range Percent Splice Strand
achi-RA 305..1100 17..812 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 08:01:28 Download gff for BO01514.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 12514130..12514244 17..131 100   Minus
2R 12513568..12514061 132..625 100 <- Minus
2R 12513360..12513508 626..774 100 <- Minus
2R 12512746..12512783 775..812 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 05:18:32 Download gff for BO01514.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8401635..8401749 17..131 100   Minus
arm_2R 8401073..8401566 132..625 100 <- Minus
arm_2R 8400865..8401013 626..774 100 <- Minus
arm_2R 8400251..8400288 775..812 100 <- Minus

BO01514.complete Sequence

1312 bp (1312 high quality bases) assembled on 2005-06-23

GenBank Submission: FJ629527

> BO01514.complete
GAAGTTATCAGTCGACATGATCTCGCCGGAACAAGAAGAGGTCAACATGG
TCCTGGATCGCCATGTACGGCAGAATATCCAGGACATGATGCACGAGGCT
CATGTCCAGGCGAGCCTGCTGGAGAACGAAGGACGCGGCCGTTTCCACTC
GGACTCAAGTTTGGACCAGGATTCTCTTCACGCTGACGTCATCGTGGAGG
AGGATCAGAGCACCGAACACGGCGCCAACCAGGTGCAAAACTACCACGAC
ATGATGGTGGACAGTGAACACCACATCGACATAAATGGGTCGCTGCGCAA
ACGTCGTGGAAATCTTCCCAAGACCTCTGTAAAGATTTTAAAGCGTTGGC
TTTATGAGCACCGCTATAACGCCTATCCGAGCGATGCGGAGAAGTTCACC
CTGTCCCAGGAGGCCAATCTGACGGTGCTCCAAGTGTGCAACTGGTTCAT
CAATGCCCGTCGCCGCATTCTACCGGAGATGATCAGGCGCGAGGGCAACG
ATCCTCTGCACTTCACCATATCGCGACGTGGCAAAAAGGTTAGCCCCAAC
TGTTCGAGATCAAGTGCGTTGGGCGCAAACTTGACTGGGCCGAATCCCGC
ACACGGAAGTCCTGCTTCCGAAGTGGTCGTTGGCGCTACAGAGGAGGTGG
ATGGCGCCGGTGAGATTCACGAGGGCATCGCCAATGTGCTGACCAACTTT
GAACAGTATGTGCAGGGCCCCAACGGACAAATGGTCAAGATGGAGCCGGA
GTACGAGGACAGTGTCATCTACAGGTCCGAAGGCGAAGAGAGTGCACAGG
GATACGAGTCCTGTGGGCCGAACAGCGAGGAGGAAGTACGCTTCGAGACC
TCCCATGATTGGCAGAGCGTTATAAAAACTGTATTTGGTACTGAGGAAGT
CAGCACTTCGGCTGGCAATAATCCAGGTACCTCTGGTTCTAAGGGATCTG
TTCAGAATACCGCCATCTGGAATCGCAATCAGACTGCGAAGCGTGACGTG
AATCAACAGTTGACTGACTTTGAAAGCGAGCTGAATAGAATACAGGCCTC
AGAAATCCAGACAATCGATCCTACCAACTCCAATCAACAGGACATTGGTG
ACAATCTACAGGCGGACGAGGTGTTTACCGGTGCCGAAGCAGAAGCTGGC
CAGAGTCAATTATCTGCTATGTCGCAGGGCACAAGTCCAGATGAGCGTGC
CAAGTACAAGTGTCTCTATTATCTAGTGGAAACTGCCATGGCTGTGCGCC
AAAACGATGACGTCCAGGATGACGATTTCGTTTACATGGGAGACGCAAGC
TTTCTAGACCAT

BO01514.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
achi-RA 1281 CG8819-PA 1..1278 17..1294 6390 100 Plus
vis-RA 1275 CG8821-PA 1..1272 17..1294 5680 96.5 Plus
achi-RD 1668 CG8819-PD 1..758 17..774 3790 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:39:36
Subject Length Description Subject Range Query Range Score Percent Strand
achi-RA 2122 CG8819-RA 305..1582 17..1294 6390 100 Plus
vis-RA 1741 CG8821-RA 94..1365 17..1294 5680 96.5 Plus
achi-RD 2277 CG8819-RD 73..830 17..774 3790 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12513566..12514063 627..130 2490 100 Minus
2R 25286936 2R 12509777..12510268 627..130 2095 95.2 Minus
2R 25286936 2R 12512254..12512435 1179..998 910 100 Minus
2R 25286936 2R 12508465..12508646 1179..998 850 97.8 Minus
2R 25286936 2R 12509569..12509720 776..625 760 100 Minus
2R 25286936 2R 12513358..12513509 776..625 760 100 Minus
2R 25286936 2R 12512501..12512622 998..877 610 100 Minus
2R 25286936 2R 12512074..12512190 1294..1178 585 100 Minus
2R 25286936 2R 12508712..12508833 998..877 580 98.4 Minus
2R 25286936 2R 12514129..12514244 132..17 580 100 Minus
2R 25286936 2R 12508893..12508997 876..772 525 100 Minus
2R 25286936 2R 12512682..12512786 876..772 525 100 Minus
2R 25286936 2R 12508272..12508388 1294..1178 495 94.9 Minus
2R 25286936 2R 12510327..12510439 129..17 445 92.9 Minus
Blast to na_te.dros performed on 2014-11-27 15:39:34 has no hits.

BO01514.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:45:30 Download gff for BO01514.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 1..1281 17..1295 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:16:11 Download gff for BO01514.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 294..1577 17..1300 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:44:18 Download gff for BO01514.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 305..1582 17..1296 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:45:30 Download gff for BO01514.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 294..1577 17..1300 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:13:10 Download gff for BO01514.complete
Subject Subject Range Query Range Percent Splice Strand
achi-RA 305..1582 17..1296 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:13:10 Download gff for BO01514.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12514130..12514244 17..131 100   Minus
2R 12513568..12514061 132..625 100 <- Minus
2R 12513360..12513508 626..774 100 <- Minus
2R 12512682..12512783 775..876 100 <- Minus
2R 12512501..12512622 877..998 100 <- Minus
2R 12512255..12512434 999..1178 100 <- Minus
2R 12512072..12512189 1179..1296 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:44:18 Download gff for BO01514.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8401635..8401749 17..131 100   Minus
arm_2R 8401073..8401566 132..625 100 <- Minus
arm_2R 8400865..8401013 626..774 100 <- Minus
arm_2R 8400187..8400288 775..876 100 <- Minus
arm_2R 8400006..8400127 877..998 100 <- Minus
arm_2R 8399760..8399939 999..1178 100 <- Minus
arm_2R 8399577..8399694 1179..1296 98 <- Minus

BO01514.pep Sequence

Translation from 16 to 1312

> BO01514.pep
MISPEQEEVNMVLDRHVRQNIQDMMHEAHVQASLLENEGRGRFHSDSSLD
QDSLHADVIVEEDQSTEHGANQVQNYHDMMVDSEHHIDINGSLRKRRGNL
PKTSVKILKRWLYEHRYNAYPSDAEKFTLSQEANLTVLQVCNWFINARRR
ILPEMIRREGNDPLHFTISRRGKKVSPNCSRSSALGANLTGPNPAHGSPA
SEVVVGATEEVDGAGEIHEGIANVLTNFEQYVQGPNGQMVKMEPEYEDSV
IYRSEGEESAQGYESCGPNSEEEVRFETSHDWQSVIKTVFGTEEVSTSAG
NNPGTSGSKGSVQNTAIWNRNQTAKRDVNQQLTDFESELNRIQASEIQTI
DPTNSNQQDIGDNLQADEVFTGAEAEAGQSQLSAMSQGTSPDERAKYKCL
YYLVETAMAVRQNDDVQDDDFVYMGDASFLDH

BO01514.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
achi-PA 426 CG8819-PA 1..426 1..426 2224 100 Plus
vis-PA 424 CG8821-PA 1..424 1..426 2110 95.3 Plus
achi-PD 555 CG8819-PD 1..309 1..316 1324 83.2 Plus
achi-PC 555 CG8819-PC 1..309 1..316 1324 83.2 Plus
vis-PB 524 CG8821-PB 1..278 1..316 1052 69.6 Plus
achi-PD 555 CG8819-PD 370..555 246..426 902 95.7 Plus
achi-PC 555 CG8819-PC 370..555 246..426 902 95.7 Plus