Clone BO04024 Report

Search the DGRC for BO04024

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:40
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptRpn6-RB
Protein status:BO04024.pep: validated full length
Sequenced Size:1300

Clone Sequence Records

BO04024.3prime Sequence

858 bp (789 high quality bases) assembled on 2005-12-01

> BO04024.3prime
ATGGTCTAGAAAGCTTGCCGACAGCTTCTTAGCCTTCTGGTACAGTGTGT
CCACCACCTTACCCATACTTTGTATGGTTTCCAGCACGCGTTCATAGGTC
TTGTCCACGGGCGTCTCTTCGAAAACAATCAGTACTCCCTCACCCTGATC
CAGAATGCCGCTGAACTTTTTGTCCAGGATCATTTGGGACAGCTTCTTTT
CCACCTGCGGCATGGGCAGCTGAATGCTCTCGGCAACATGGGCGACCTGC
ACACGAGAGTAGGGTTCAATGATGCGGCACAAGTTTTGCTCCAACATGGT
GTCGTATAACGTGCCCAAATGCGCCTGCACAATCACATCCTCGGCGAGCT
CCTTTTTGTATTCCTTGAGGGCAGCCTGGAAGTCGGCCAGGGAACGTTTG
TGTGAAGCCTCAGCCACTGATTTCATAGCATCTATATCGCGGCCCGAATA
GGTAATAGCCAGCTTTCCACTGACGAGCTGGTTGACATCATCGGACTGTC
CCAACATGATTTTGCACAGCAACATGTATTTAAGCGAGGTCAAGGCCTTG
ACGCTGTCCACGCTGTCGAATCCTTCAAAGGCCTCGTAGAAATAGGAGAA
TGCGGTCTTAAAGTCACGCTCATCAGCCGCATGTAGGATGCCGGACTGAA
GATCCAGTGCGCCTTGCACCTTTGGCGGACAGTAGATAGCATTGGCCGTG
GTGCGGGCTGAGGTGAGGGCGGCCCTAGCCTTGGGCAGGTTGCTCAGTGC
GTGATAGGTTTTGCTCTCCAGCAGCTGCACTTCCACCAGCAGATTCTTGT
CATCCAGCTTTTTCAGCTCGCGCAGCAATTGGGCACCCAGAGCCCAGGCC
TCCGTGTA

BO04024.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG10149-PA 1320 Rpn6-RA 478..1317 858..19 4175 99.8 Minus
CG10149-PB 1269 Rpn6-RB 427..1266 858..19 4175 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn6-RC 1662 CG10149-RC 500..1339 858..19 4185 99.9 Minus
Rpn6-RB 1827 CG10149-RB 665..1504 858..19 4185 99.9 Minus
Rpn6-RA 1612 CG10149-RA 552..1391 858..19 4185 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 15:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14751144..14751543 459..858 1985 99.8 Plus
2R 25286936 2R 14750489..14750720 19..250 1160 100 Plus
2R 25286936 2R 14750781..14750996 245..460 1080 100 Plus
Blast to na_te.dros performed on 2015-02-13 15:08:17 has no hits.

BO04024.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:52:47 Download gff for BO04024.3prime
Subject Subject Range Query Range Percent Splice Strand
Rpn6-PB 428..1269 15..857 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:00:59 Download gff for BO04024.3prime
Subject Subject Range Query Range Percent Splice Strand
CG10149-PB 428..1269 15..857 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:00:32 Download gff for BO04024.3prime
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RA 553..1396 13..857 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:44:12 Download gff for BO04024.3prime
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RA 553..1396 13..857 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:44:12 Download gff for BO04024.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 14751145..14751542 460..857 99   Plus
2R 14750783..14750995 247..459 100 <- Plus
2R 14750484..14750716 13..246 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:00:32 Download gff for BO04024.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10638650..10639047 460..857 99   Plus
arm_2R 10638288..10638500 247..459 100 <- Plus
arm_2R 10637989..10638221 13..246 99 <- Plus

BO04024.5prime Sequence

881 bp (819 high quality bases) assembled on 2005-12-01

> BO04024.5prime
GAAGTTATCAGTCGACATGGCCGGAGCAACACTTTTCGAGCGTGCCCAGG
CATTGTCCAGCGTGAATCGCGAGGAGCAGGATAGTTCGCTGCTGAACAAA
CTGGTCCGCGACCAGGAGGGCGCCGAGAACGATGAGGAGCGCATCCGAAT
CAAGGAGCAGGGCATTCTGCAGCAGGGCGAGCTCTACAAGCAGGAGGGCA
AGGCCAAGGAGCTGGCCGATCTCATCAAGGTGACGCGTCCGTTCCTCAGC
TCGATCAGCAAGGCCAAGGCGGCCAAGCTGGTGCGTTCGCTGGTGGACAT
GTTCCTGGACATGGACGCGGGCACAGGCATTGAGGTTCAATTGTGTAAAG
ACTGCATTGAGTGGGCCAAACAGGAGAAGCGCACATTTCTTCGCCAATCG
CTGGAAGCTCGTCTGATTGCCTTATATTTTGATACTGCTTTGTACACGGA
GGCCTTGGCTCTGGGTGCCCAATTGCTGCGCGAGCTGAAAAAGCTGGATG
ACAAGAATCTGCTGGTGGAAGTGCAGCTGCTGGAGAGCAAAACCTATCAC
GCACTGAGCAACCTGCCCAAGGCTAGGGCCGCCCTCACCTCAGCCCGCAC
CACGGCCAATGCTATCTACTGTCCGCCAAAGGTGCAAGGCGCACTGGATC
TTCAGTCCGGCATCCTACATGCGGCTGATGAGCGTGACTTTAAGACCGCA
TTCTCCTATTTCTACGAGGCCTTTGAAGGATTCGACAGCGTGGACAGCGT
CAAGGCCTTGACCTCGCTTAAATACATGTTGCTGTGCAAAATCATGTTGG
GACAGTCCGATGATGTCAACCAGCTCGTCAGTGGAAAGCTGGCTATTACC
TATTCGGGCCGCGATATAGATGCTATGAAAT

BO04024.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG10149-PA 1320 Rpn6-RA 52..916 17..881 4325 100 Plus
CG10149-PB 1269 Rpn6-RB 1..865 17..881 4325 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 15:58:26
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn6-RC 1662 CG10149-RC 74..938 17..881 4325 100 Plus
Rpn6-RB 1827 CG10149-RB 239..1103 17..881 4325 100 Plus
Rpn6-RA 1612 CG10149-RA 126..990 17..881 4325 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 15:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14751144..14751653 842..333 2550 100 Minus
2R 25286936 2R 14751714..14752033 336..17 1600 100 Minus
2R 25286936 2R 14750956..14750996 881..841 205 100 Minus
Blast to na_te.dros performed on 2015-02-12 15:58:26 has no hits.

BO04024.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:52:48 Download gff for BO04024.5prime
Subject Subject Range Query Range Percent Splice Strand
Rpn6-PB 1..865 17..881 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:01:00 Download gff for BO04024.5prime
Subject Subject Range Query Range Percent Splice Strand
CG10149-PB 1..865 17..881 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:27:23 Download gff for BO04024.5prime
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RA 119..990 8..881 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:31:44 Download gff for BO04024.5prime
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RA 119..990 8..881 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:31:44 Download gff for BO04024.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 14751716..14752047 5..334 98   Minus
2R 14751145..14751651 335..841 100 <- Minus
2R 14750956..14750995 842..881 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:27:23 Download gff for BO04024.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10639221..10639552 5..334 98   Minus
arm_2R 10638650..10639156 335..841 100 <- Minus
arm_2R 10638461..10638500 842..881 100 <- Minus

BO04024.complete Sequence

1300 bp (1300 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629602

> BO04024.complete
GAAGTTATCAGTCGACATGGCCGGAGCAACACTTTTCGAGCGTGCCCAGG
CATTGTCCAGCGTGAATCGCGAGGAGCAGGATAGTTCGCTGCTGAACAAA
CTGGTCCGCGACCAGGAGGGCGCCGAGAACGATGAGGAGCGCATCCGAAT
CAAGGAGCAGGGCATTCTGCAGCAGGGCGAGCTCTACAAGCAGGAGGGCA
AGGCCAAGGAGCTGGCCGATCTCATCAAGGTGACGCGTCCGTTCCTCAGC
TCGATCAGCAAGGCCAAGGCGGCCAAGCTGGTGCGTTCGCTGGTGGACAT
GTTCCTGGACATGGACGCGGGCACAGGCATTGAGGTTCAATTGTGTAAAG
ACTGCATTGAGTGGGCCAAACAGGAGAAGCGCACATTTCTTCGCCAATCG
CTGGAAGCTCGTCTGATTGCCTTATATTTTGATACTGCTTTGTACACGGA
GGCCTTGGCTCTGGGTGCCCAATTGCTGCGCGAGCTGAAAAAGCTGGATG
ACAAGAATCTGCTGGTGGAAGTGCAGCTGCTGGAGAGCAAAACCTATCAC
GCACTGAGCAACCTGCCCAAGGCTAGGGCCGCCCTCACCTCAGCCCGCAC
CACGGCCAATGCTATCTACTGTCCGCCAAAGGTGCAAGGCGCACTGGATC
TTCAGTCCGGCATCCTACATGCGGCTGATGAGCGTGACTTTAAGACCGCA
TTCTCCTATTTCTACGAGGCCTTTGAAGGATTCGACAGCGTGGACAGCGT
CAAGGCCTTGACCTCGCTTAAATACATGTTGCTGTGCAAAATCATGTTGG
GACAGTCCGATGATGTCAACCAGCTCGTCAGTGGAAAGCTGGCTATTACC
TATTCGGGCCGCGATATAGATGCTATGAAATCAGTGGCTGAGGCTTCACA
CAAACGTTCCCTGGCCGACTTCCAGGCTGCCCTCAAGGAATACAAAAAGG
AGCTCGCCGAGGATGTGATTGTGCAGGCGCATTTGGGCACGTTATACGAC
ACCATGTTGGAGCAAAACTTGTGCCGCATCATTGAACCCTACTCTCGTGT
GCAGGTCGCCCATGTTGCCGAGAGCATTCAGCTGCCCATGCCGCAGGTGG
AAAAGAAGCTGTCCCAAATGATCCTGGACAAAAAGTTCAGCGGCATTCTG
GATCAGGGTGAGGGAGTACTGATTGTTTTCGAAGAGACGCCCGTGGACAA
GACCTATGAACGCGTGCTGGAAACCATACAAAGTATGGGTAAGGTGGTGG
ACACACTGTACCAGAAGGCTAAGAAGCTGTCGGCAAGCTTTCTAGACCAT

BO04024.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:42:55
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn6-RC 1269 CG10149-PC 1..1266 17..1282 6330 100 Plus
Rpn6-RB 1269 CG10149-PB 1..1266 17..1282 6330 100 Plus
Rpn6-RA 1320 CG10149-PA 52..1317 17..1282 6330 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:42:56
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn6-RC 1662 CG10149-RC 74..1339 17..1282 6330 100 Plus
Rpn6-RB 1827 CG10149-RB 239..1504 17..1282 6330 100 Plus
Rpn6-RA 1612 CG10149-RA 126..1391 17..1282 6330 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14751144..14751653 842..333 2550 100 Minus
2R 25286936 2R 14751714..14752033 336..17 1600 100 Minus
2R 25286936 2R 14750489..14750720 1282..1051 1160 100 Minus
2R 25286936 2R 14750781..14750996 1056..841 1080 100 Minus
Blast to na_te.dros performed on 2014-11-28 00:42:53 has no hits.

BO04024.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:42:58 Download gff for BO04024.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RB 1..1269 17..1286 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:12:58 Download gff for BO04024.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RB 272..1556 5..1288 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:30:07 Download gff for BO04024.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RA 126..1391 17..1284 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:42:58 Download gff for BO04024.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RB 272..1556 5..1288 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:36:41 Download gff for BO04024.complete
Subject Subject Range Query Range Percent Splice Strand
Rpn6-RA 126..1391 17..1284 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:36:41 Download gff for BO04024.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14751716..14752033 17..334 100   Minus
2R 14751145..14751651 335..841 100 <- Minus
2R 14750783..14750995 842..1054 100 <- Minus
2R 14750487..14750716 1055..1284 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:30:07 Download gff for BO04024.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10639221..10639538 17..334 100   Minus
arm_2R 10638650..10639156 335..841 100 <- Minus
arm_2R 10638288..10638500 842..1054 100 <- Minus
arm_2R 10637992..10638221 1055..1284 99 <- Minus

BO04024.pep Sequence

Translation from 16 to 1300

> BO04024.pep
MAGATLFERAQALSSVNREEQDSSLLNKLVRDQEGAENDEERIRIKEQGI
LQQGELYKQEGKAKELADLIKVTRPFLSSISKAKAAKLVRSLVDMFLDMD
AGTGIEVQLCKDCIEWAKQEKRTFLRQSLEARLIALYFDTALYTEALALG
AQLLRELKKLDDKNLLVEVQLLESKTYHALSNLPKARAALTSARTTANAI
YCPPKVQGALDLQSGILHAADERDFKTAFSYFYEAFEGFDSVDSVKALTS
LKYMLLCKIMLGQSDDVNQLVSGKLAITYSGRDIDAMKSVAEASHKRSLA
DFQAALKEYKKELAEDVIVQAHLGTLYDTMLEQNLCRIIEPYSRVQVAHV
AESIQLPMPQVEKKLSQMILDKKFSGILDQGEGVLIVFEETPVDKTYERV
LETIQSMGKVVDTLYQKAKKLSASFLDH

BO04024.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:54:03
Subject Length Description Subject Range Query Range Score Percent Strand
Rpn6-PC 422 CG10149-PC 1..422 1..422 2086 100 Plus
Rpn6-PB 422 CG10149-PB 1..422 1..422 2086 100 Plus
Rpn6-PA 439 CG10149-PA 18..439 1..422 2086 100 Plus
alien-PD 444 CG9556-PD 41..410 15..385 233 22.3 Plus
alien-PE 444 CG9556-PE 41..410 15..385 233 22.3 Plus