Clone BO04030 Report

Search the DGRC for BO04030

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:40
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptRad23-RA
Protein status:BO04030.pep: validated full length
Sequenced Size:1276

Clone Sequence Records

BO04030.3prime Sequence

834 bp (742 high quality bases) assembled on 2005-12-01

> BO04030.3prime
ATGGTCTAGAAAGCTTGCATCATCGAAGCTAGACGATAGCAAAAAATTAG
CTGCTTGTTCCTCGTTCTTTTCACAAGCGAAGTACGCTTGCAGTACAAGG
GCCTCTGGGAATCCAAGAGCTTTTAGCCGTTCTATTGCGTCCTTATCTTG
GCGATTTAAACGAATGGTTGATACTCCTAAAGGTTGTTCCAAGTCTTCGT
TATCCGCTGCGCTACCGCTTTGATGTGCTGCACTTGTACCCGCGGCTGAT
CTTTGTGCTGAAGTAGCTACTTCTAAATCTGGAGAAAAGAGGTCAACATT
GTCCAAAGTTGAAGGAATCCGCGCATTCGAAACGGGAGGAACGGTGGCGC
CTGACTCCGATTCGCGGTCAATCGGTTGATTAAGCATATTGAGAAACGCA
TCTTGGTTCTCCGAAATAAGTTGTAAAAGGGCTGGGTTTGTCTGACCAAT
CTGCTGCAATACTGCATGCAAAAGATGAGGGTTTTGATAAATTAAAGATC
GCATTTGAAGAAACTGTGGCTGGCTACGTAAAAATTCAAAGGGGTCTGAA
TTTGATTCTGTTGAACGCTCGGCAGAGGTTGCCGACGCAGGTTGCGGTCC
GGAGGGGATTAGACTAGGATTCGTTGATTCATTCAGCCTATTGTAAAAAG
TACCTTCCTCTGCAGGTATGCCATTAATGAGATATTCAACGGCTCTTTCC
GGGTTGTTATAACTAGCAGCCATCGCACGTTCAACCTGCTCTCTTGGGTA
ACCCATTTCCACCATTGATAGGACTGTTTGGTTGTATTCGTCACCCATAA
GCAAATTAGATTCAGCGCGCGATTGTAANGAAGC

BO04030.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG1836-PB 1032 Rad23-RB 214..1029 834..19 4061 99.8 Minus
CG1836-PA 1245 Rad23-RA 427..1242 834..19 4061 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
Rad23-RC 2009 CG1836-RC 558..1373 834..19 4069 99.9 Minus
Rad23-RA 1489 CG1836-RA 558..1373 834..19 4069 99.9 Minus
Rad23-RB 1507 CG1836-RB 576..1391 834..19 4069 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 15:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 309692..310017 452..127 1630 100 Minus
4 1348131 4 308791..309079 834..546 1434 99.7 Minus
4 1348131 4 310078..310186 127..19 545 100 Minus
4 1348131 4 309534..309633 550..451 500 100 Minus
Blast to na_te.dros performed on 2015-02-13 15:08:47 has no hits.

BO04030.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:52:53 Download gff for BO04030.3prime
Subject Subject Range Query Range Percent Splice Strand
Rad23-PA 427..1245 18..834 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:01:06 Download gff for BO04030.3prime
Subject Subject Range Query Range Percent Splice Strand
CG1836-PA 427..1245 18..834 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:00:37 Download gff for BO04030.3prime
Subject Subject Range Query Range Percent Splice Strand
Rad23-RB 576..1391 19..834 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:44:29 Download gff for BO04030.3prime
Subject Subject Range Query Range Percent Splice Strand
Rad23-RB 576..1391 19..834 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:44:29 Download gff for BO04030.3prime
Subject Subject Range Query Range Percent Splice Strand
4 310079..310186 19..126 100   Minus
4 309694..310017 127..450 100 -> Minus
4 309539..309633 451..545 100 -> Minus
4 308791..309079 546..834 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:00:37 Download gff for BO04030.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_4 330705..330812 19..126 100   Minus
arm_4 330320..330643 127..450 100 -> Minus
arm_4 330165..330259 451..545 100 -> Minus
arm_4 329417..329705 546..834 99 -> Minus

BO04030.5prime Sequence

894 bp (752 high quality bases) assembled on 2005-12-01

> BO04030.5prime
GAAGTTATCAGTCGACATGATTATTACAATTAAAAATCTTCAACAGCAAA
CTTTTACTATTGAGTTTGCCCCGGAAAAAACGGTTTTGGAACTGAAGAAG
AAAATATTCGAGGAGCGCGGTCCAGAGTACGTCGCCGAAAAACAAAAACT
GATCTACGCTGGCGTCATATTGACGGATGACCGCACCGTTGGTTCATACA
ACGTTGATGAAAAAAAGTTCATTGTGGTAATGTTGACACGCGATTCGTCT
AGTTCAAATCGTAATCAACTTAGTGTAAAAGAAAGTAATAAATTGACTAG
CACCGACGATTCAAAGCAATCTATGCCTTGCGAAGAAGCCAACCATACCA
ATTCGCCTAGTTCCACAAATACAGAAGATTCAGTTTTATCACGTGAAACC
AGACCTTTATCTAGTGACGAATTGATTGGCGAGTTGGCCCAGGCTTCCTT
ACAATCGCGCGCTGAATCTAATTTGCTTATGGGTGACGAATACAACCAAA
CAGTCCTATCAATGGTGGAAATGGGTTACCCAAGAGAGCAGGTTGAACGT
GCGATGGCTGCTAGTTATAACAACCCGGAAAGAGCCGTTGAATATCTCAT
TAATGGCATACCTGCAGAGGAAGGTACTTTTTACAATAGGCTGAATGAAT
CAACGAATCCTAGTCTAATCCCCTCCGGACCGCAACCTGCGTCGGCAACC
TCTGCCGAGCGTTCAACAGAATCAAATTCAGACCCCTTTGAATTTTTACG
TAGCCAGCCACAGTTTCTTCAAATGCGATCTTTAATTTATCAAAACCCTC
ATCTTTTGCATGCAGTATTGCAGCAGATTGGTCAGACAAACCCAGCCCTT
TTACAACTTATTTCGGAGAACCAAGATGCGTTTCTCAATATGCT

BO04030.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:57:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG1836-PA 1245 Rad23-RA 1..878 17..894 4390 100 Plus
CG1836-PB 1032 Rad23-RB 1..665 230..894 3325 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:08:54
Subject Length Description Subject Range Query Range Score Percent Strand
Rad23-RC 2009 CG1836-RC 132..1009 17..894 4390 100 Plus
Rad23-RA 1489 CG1836-RA 132..1009 17..894 4390 100 Plus
Rad23-RB 1507 CG1836-RB 132..1027 17..894 4200 98 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 15:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 308426..309079 78..731 3255 99.8 Plus
4 1348131 4 309534..309633 727..826 500 100 Plus
4 1348131 4 309692..309761 825..894 350 100 Plus
4 1348131 4 308224..308291 17..84 340 100 Plus
Blast to na_te.dros performed on 2015-02-13 15:08:52 has no hits.

BO04030.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:52:54 Download gff for BO04030.5prime
Subject Subject Range Query Range Percent Splice Strand
Rad23-PA 1..878 17..894 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:01:08 Download gff for BO04030.5prime
Subject Subject Range Query Range Percent Splice Strand
CG1836-PA 1..878 17..894 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:00:38 Download gff for BO04030.5prime
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 126..1009 9..894 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:44:34 Download gff for BO04030.5prime
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 126..1009 9..894 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:44:34 Download gff for BO04030.5prime
Subject Subject Range Query Range Percent Splice Strand
4 309694..309761 827..894 100   Plus
4 309539..309633 732..826 100 -> Plus
4 308431..309079 83..731 100 -> Plus
4 308218..308289 9..82 94 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:00:38 Download gff for BO04030.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_4 330320..330387 827..894 100   Plus
arm_4 330165..330259 732..826 100 -> Plus
arm_4 329057..329705 83..731 100 -> Plus
arm_4 328844..328915 9..82 94 -> Plus

BO04030.complete Sequence

1276 bp (1276 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629605

> BO04030.complete
GAAGTTATCAGTCGACATGATTATTACAATTAAAAATCTTCAACAGCAAA
CTTTTACTATTGAGTTTGCCCCGGAAAAAACGGTTTTGGAACTGAAGAAG
AAAATATTCGAGGAGCGCGGTCCAGAGTACGTCGCCGAAAAACAAAAACT
GATCTACGCTGGCGTCATATTGACGGATGACCGCACCGTTGGTTCATACA
ACGTTGATGAAAAAAAGTTCATTGTGGTAATGTTGACACGCGATTCGTCT
AGTTCAAATCGTAATCAACTTAGTGTAAAAGAAAGTAATAAATTGACTAG
CACCGACGATTCAAAGCAATCTATGCCTTGCGAAGAAGCCAACCATACCA
ATTCGCCTAGTTCCACAAATACAGAAGATTCAGTTTTATCACGTGAAACC
AGACCTTTATCTAGTGACGAATTGATTGGCGAGTTGGCCCAGGCTTCCTT
ACAATCGCGCGCTGAATCTAATTTGCTTATGGGTGACGAATACAACCAAA
CAGTCCTATCAATGGTGGAAATGGGTTACCCAAGAGAGCAGGTTGAACGT
GCGATGGCTGCTAGTTATAACAACCCGGAAAGAGCCGTTGAATATCTCAT
TAATGGCATACCTGCAGAGGAAGGTACTTTTTACAATAGGCTGAATGAAT
CAACGAATCCTAGTCTAATCCCCTCCGGACCGCAACCTGCGTCGGCAACC
TCTGCCGAGCGTTCAACAGAATCAAATTCAGACCCCTTTGAATTTTTACG
TAGCCAGCCACAGTTTCTTCAAATGCGATCTTTAATTTATCAAAACCCTC
ATCTTTTGCATGCAGTATTGCAGCAGATTGGTCAGACAAACCCAGCCCTT
TTACAACTTATTTCGGAGAACCAAGATGCGTTTCTCAATATGCTTAATCA
ACCGATTGACCGCGAATCGGAGTCAGGCGCCACCGTTCCTCCCGTTTCGA
ATGCGCGGATTCCTTCAACTTTGGACAATGTTGACCTCTTTTCTCCAGAT
TTAGAAGTAGCTACTTCAGCACAAAGATCAGCCGCGGGTACAAGTGCAGC
ACATCAAAGCGGTAGCGCAGCGGATAACGAAGACTTGGAACAACCTTTAG
GAGTATCAACCATTCGTTTAAATCGCCAAGATAAGGACGCAATAGAACGG
CTAAAAGCTCTTGGATTCCCAGAGGCCCTTGTACTGCAAGCGTACTTCGC
TTGTGAAAAGAACGAGGAACAAGCAGCTAATTTTTTGCTATCGTCTAGCT
TCGATGATGCAAGCTTTCTAGACCAT

BO04030.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
Rad23-RC 1245 CG1836-PC 1..1242 17..1258 6210 100 Plus
Rad23-RA 1245 CG1836-PA 1..1242 17..1258 6210 100 Plus
Rad23-RB 1032 CG1836-PB 1..1029 230..1258 5145 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
Rad23-RC 2009 CG1836-RC 132..1373 17..1258 6210 100 Plus
Rad23-RA 1489 CG1836-RA 132..1373 17..1258 6210 100 Plus
Rad23-RB 1507 CG1836-RB 132..1391 17..1258 5995 98.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:54:55
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 308426..309079 78..731 3255 99.8 Plus
4 1348131 4 309692..310017 825..1150 1630 100 Plus
4 1348131 4 310078..310186 1150..1258 545 100 Plus
4 1348131 4 309534..309633 727..826 500 100 Plus
4 1348131 4 308224..308291 17..84 340 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:54:56 has no hits.

BO04030.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:42:43 Download gff for BO04030.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 1..1245 17..1259 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:12:42 Download gff for BO04030.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 112..1359 9..1258 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:00:32 Download gff for BO04030.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 132..1373 17..1260 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:42:43 Download gff for BO04030.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 112..1359 9..1258 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:29:58 Download gff for BO04030.complete
Subject Subject Range Query Range Percent Splice Strand
Rad23-RA 132..1373 17..1260 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:29:58 Download gff for BO04030.complete
Subject Subject Range Query Range Percent Splice Strand
4 310079..310186 1151..1260 98   Plus
4 309694..310017 827..1150 100 -> Plus
4 309539..309633 732..826 100 -> Plus
4 308431..309079 83..731 100 -> Plus
4 308224..308289 17..82 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:00:32 Download gff for BO04030.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 330705..330812 1151..1260 98   Plus
arm_4 330320..330643 827..1150 100 -> Plus
arm_4 330165..330259 732..826 100 -> Plus
arm_4 329057..329705 83..731 100 -> Plus
arm_4 328850..328915 17..82 100 -> Plus

BO04030.pep Sequence

Translation from 16 to 1276

> BO04030.pep
MIITIKNLQQQTFTIEFAPEKTVLELKKKIFEERGPEYVAEKQKLIYAGV
ILTDDRTVGSYNVDEKKFIVVMLTRDSSSSNRNQLSVKESNKLTSTDDSK
QSMPCEEANHTNSPSSTNTEDSVLSRETRPLSSDELIGELAQASLQSRAE
SNLLMGDEYNQTVLSMVEMGYPREQVERAMAASYNNPERAVEYLINGIPA
EEGTFYNRLNESTNPSLIPSGPQPASATSAERSTESNSDPFEFLRSQPQF
LQMRSLIYQNPHLLHAVLQQIGQTNPALLQLISENQDAFLNMLNQPIDRE
SESGATVPPVSNARIPSTLDNVDLFSPDLEVATSAQRSAAGTSAAHQSGS
AADNEDLEQPLGVSTIRLNRQDKDAIERLKALGFPEALVLQAYFACEKNE
EQAANFLLSSSFDDASFLDH

BO04030.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
Rad23-PC 414 CG1836-PC 1..414 1..414 2071 100 Plus
Rad23-PA 414 CG1836-PA 1..414 1..414 2071 100 Plus
Rad23-PB 343 CG1836-PB 1..343 72..414 1718 100 Plus
CG10694-PA 290 CG10694-PA 1..288 1..414 293 24.9 Plus