Clone BO04073 Report

Search the DGRC for BO04073

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:40
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptAP-1sigma-RA
Protein status:BO04073.pep: validated full length
Sequenced Size:505

Clone Sequence Records

BO04073.5prime Sequence

503 bp (502 high quality bases) assembled on 2005-12-01

> BO04073.5prime
GAAGTTATCAGTCGACATGATGCTTTTCATGCTGCTGTTTAGTCGGCAGG
GCAAACTGCGGTTACAAAAGTGGTACATGGCCTATCCGGATAAGGTGAAA
AAGAAGATCACCCGGGAACTGGTCACTACGATACTGGCCCGCAAGCCCAA
AATGTGCTCCTTTCTGGAGTGGAAGGACTGCAAAATTGTCTACAAAAGGT
ATGCCAGCTTGTATTTCTGTTGCGCCATCGAGCAGAACGACAACGAACTG
CTGACACTGGAGATCATTCATCGCTATGTGGAGCTGTTGGATAAGTACTT
CGGCAGCGTCTGCGAGCTGGACATTATCTTTAACTTTGAAAAAGCATACT
TTATCCTGGATGAGCTGCTCATTGGCGGCGAAATCCAGGAGACGTCCAAA
AAGAACGTACTTAAGGCGATTGCCTCGCAGGATCTGCTCCAAGAGGATGA
GACCCCGCAGAGTTTCTTCGACGATCACGGCCTGGGCGCAAGCTTTCTAG
ACC

BO04073.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:58:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG5864-PA 474 AP-1sigma-RA 1..471 17..487 2355 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 15:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-RA 1079 CG5864-RA 146..616 17..487 2355 100 Plus
AP-1sigma-RC 795 CG5864-RC 146..576 17..447 2155 100 Plus
AP-1sigma-RB 1181 CG5864-RB 146..576 17..447 2155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 15:58:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23959031..23959212 19..200 910 100 Plus
3R 32079331 3R 23959456..23959594 308..446 695 100 Plus
3R 32079331 3R 23959278..23959390 197..309 565 100 Plus
3R 32079331 3R 23962049..23962092 444..487 220 100 Plus
Blast to na_te.dros performed on 2015-02-12 15:59:00 has no hits.

BO04073.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:53:53 Download gff for BO04073.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5864-PA 1..474 17..491 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:02:39 Download gff for BO04073.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5864-PA 1..474 17..491 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:27:37 Download gff for BO04073.5prime
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 146..622 17..495 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:32:31 Download gff for BO04073.5prime
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 146..622 17..495 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:32:31 Download gff for BO04073.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 23962051..23962098 446..495 94   Plus
3R 23959456..23959593 308..445 100 -> Plus
3R 23959280..23959388 199..307 100 -> Plus
3R 23959027..23959210 12..198 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:27:37 Download gff for BO04073.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19787773..19787820 446..495 94   Plus
arm_3R 19785178..19785315 308..445 100 -> Plus
arm_3R 19785002..19785110 199..307 100 -> Plus
arm_3R 19784749..19784932 12..198 98 -> Plus

BO04073.3prime Sequence

503 bp (502 high quality bases) assembled on 2005-12-01

> BO04073.3prime
ATGGTCTAGAAAGCTTGCGCCCAGGCCGTGATCGTCGAAGAAACTCTGCG
GGGTCTCATCCTCTTGGAGCAGATCCTGCGAGGCAATCGCCTTAAGTACG
TTCTTTTTGGACGTCTCCTGGATTTCGCCGCCAATGAGCAGCTCATCCAG
GATAAAGTATGCTTTTTCAAAGTTAAAGATAATGTCCAGCTCGCAGACGC
TGCCGAAGTACTTATCCAACAGCTCCACATAGCGATGAATGATCTCCAGT
GTCAGCAGTTCGTTGTCGTTCTGCTCGATGGCGCAACAGAAATACAAGCT
GGCATACCTTTTGTAGACAATTTTGCAGTCCTTCCACTCCAGAAAGGAGC
ACATTTTGGGCTTGCGGGCCAGTATCGTAGTGACCAGTTCCCGGGTGATC
TTCTTTTTCACCTTATCCGGATAGGCCATGTACCACTTTTGTAACCGCAG
TTTGCCCTGCCGACTAAACAGCAGCATGAAAAGCATCATGTCGACTGATA
ACT

BO04073.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG5864-PA 474 AP-1sigma-RA 1..471 489..19 2355 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:39:27
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-RA 1079 CG5864-RA 146..616 489..19 2355 100 Minus
AP-1sigma-RC 795 CG5864-RC 146..576 489..59 2155 100 Minus
AP-1sigma-RB 1181 CG5864-RB 146..576 489..59 2155 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23959031..23959212 487..306 910 100 Minus
3R 32079331 3R 23959456..23959594 198..60 695 100 Minus
3R 32079331 3R 23959278..23959390 309..197 565 100 Minus
3R 32079331 3R 23962049..23962092 62..19 220 100 Minus
Blast to na_te.dros performed on 2015-02-11 04:39:26 has no hits.

BO04073.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:53:52 Download gff for BO04073.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5864-PA 1..474 15..489 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:02:37 Download gff for BO04073.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5864-PA 1..474 15..489 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:11:28 Download gff for BO04073.3prime
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 146..622 11..489 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:10:26 Download gff for BO04073.3prime
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 146..622 11..489 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:10:26 Download gff for BO04073.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 23962051..23962098 11..60 94   Minus
3R 23959456..23959593 61..198 100 -> Minus
3R 23959280..23959388 199..307 100 -> Minus
3R 23959027..23959210 308..494 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:11:28 Download gff for BO04073.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19787773..19787820 11..60 94   Minus
arm_3R 19785178..19785315 61..198 100 -> Minus
arm_3R 19785002..19785110 199..307 100 -> Minus
arm_3R 19784749..19784932 308..494 98 -> Minus

BO04073.complete Sequence

505 bp (505 high quality bases) assembled on 2005-10-17

GenBank Submission: FJ629628

> BO04073.complete
GAAGTTATCAGTCGACATGATGCTTTTCATGCTGCTGTTTAGTCGGCAGG
GCAAACTGCGGTTACAAAAGTGGTACATGGCCTATCCGGATAAGGTGAAA
AAGAAGATCACCCGGGAACTGGTCACTACGATACTGGCCCGCAAGCCCAA
AATGTGCTCCTTTCTGGAGTGGAAGGACTGCAAAATTGTCTACAAAAGGT
ATGCCAGCTTGTATTTCTGTTGCGCCATCGAGCAGAACGACAACGAACTG
CTGACACTGGAGATCATTCATCGCTATGTGGAGCTGTTGGATAAGTACTT
CGGCAGCGTCTGCGAGCTGGACATTATCTTTAACTTTGAAAAAGCATACT
TTATCCTGGATGAGCTGCTCATTGGCGGCGAAATCCAGGAGACGTCCAAA
AAGAACGTACTTAAGGCGATTGCCTCGCAGGATCTGCTCCAAGAGGATGA
GACCCCGCAGAGTTTCTTCGACGATCACGGCCTGGGCGCAAGCTTTCTAG
ACCAT

BO04073.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-RA 474 CG5864-PA 1..471 17..487 2355 100 Plus
AP-1sigma-RC 474 CG5864-PC 1..431 17..447 2155 100 Plus
AP-1sigma-RB 474 CG5864-PB 1..431 17..447 2155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:04:48
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-RA 1079 CG5864-RA 146..616 17..487 2355 100 Plus
AP-1sigma-RC 795 CG5864-RC 146..576 17..447 2155 100 Plus
AP-1sigma-RB 1181 CG5864-RB 146..576 17..447 2155 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23959031..23959212 19..200 910 100 Plus
3R 32079331 3R 23959456..23959594 308..446 695 100 Plus
3R 32079331 3R 23959278..23959390 197..309 565 100 Plus
3R 32079331 3R 23962049..23962092 444..487 220 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:04:45 has no hits.

BO04073.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:33:25 Download gff for BO04073.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 1..474 17..491 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:00:46 Download gff for BO04073.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 143..619 17..495 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:45:04 Download gff for BO04073.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 146..616 17..489 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:33:25 Download gff for BO04073.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 143..619 17..495 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:14:04 Download gff for BO04073.complete
Subject Subject Range Query Range Percent Splice Strand
AP-1sigma-RA 146..616 17..489 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:14:04 Download gff for BO04073.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23962051..23962092 446..489 95   Plus
3R 23959456..23959593 308..445 100 -> Plus
3R 23959280..23959388 199..307 100 -> Plus
3R 23959030..23959210 17..198 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:45:04 Download gff for BO04073.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19787773..19787814 446..489 95   Plus
arm_3R 19785178..19785315 308..445 100 -> Plus
arm_3R 19785002..19785110 199..307 100 -> Plus
arm_3R 19784752..19784932 17..198 99 -> Plus

BO04073.pep Sequence

Translation from 16 to 505

> BO04073.pep
MMLFMLLFSRQGKLRLQKWYMAYPDKVKKKITRELVTTILARKPKMCSFL
EWKDCKIVYKRYASLYFCCAIEQNDNELLTLEIIHRYVELLDKYFGSVCE
LDIIFNFEKAYFILDELLIGGEIQETSKKNVLKAIASQDLLQEDETPQSF
FDDHGLGASFLDH

BO04073.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
AP-1sigma-PA 157 CG5864-PA 1..157 1..157 821 100 Plus
AP-1sigma-PC 157 CG5864-PC 1..156 1..156 761 94.9 Plus
AP-1sigma-PB 157 CG5864-PB 1..156 1..156 761 94.9 Plus
AP-1sigma-PD 152 CG5864-PD 1..145 1..145 746 99.3 Plus
AP-2sigma-PA 142 CG6056-PA 1..142 1..142 366 46.5 Plus