Clone BO04163 Report

Search the DGRC for BO04163

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:41
Well:63
Vector:pDNR-Dual
Associated Gene/TranscriptProsbeta5-RA
Protein status:BO04163.pep: validated full length
Sequenced Size:880

Clone Sequence Records

BO04163.3prime Sequence

871 bp (810 high quality bases) assembled on 2005-12-01

> BO04163.3prime
ATGGTCTAGAAAGCTTGCCTTAGCGGCCTGCTGCTTCAACTGCTCCTGGT
ACATGTAGTGCAGCTCCATGCAGTCGGTGTTGGAGATGTTTACCCAGCCG
TCCTCCTTAATGTGATACACGCGAATGATACCACCGGAGTAGGCATCCCT
GAAGGTGGCATGGTAGATGGCGCGACGTCCCAGCTCCTGGGCCTCCTTGT
CCTCCAGGTCCCAATGATAGCCAGAGTCCAGGACACCGTAGGCGTACAGC
GATCCACTACCAACAGAGAACAAATTGCCAGGCGTGCGAGATCCCTCGGA
GTCCACATAGTAGAGGCCTGGACCACGCTTATCGTAACCGGCCAGCATCA
TGCCCATGCTCAGACCCATTCCCTTGTATTCGTGGGCAATGTTGGCCATT
ATCTTGCTGGCGGCGGCCACCGAGATGCGTTCCTTGTTTCGAAGCTCGTG
AAGGCGGCATTCCTTCGAAAGGACCCTGTCCCAGTAAACGCAATCGGCTG
CGCCACCGGCCAAGGTGCCCAGCATGAACTGATTGATCTCCACGATCTTC
TTCATCGACTGGGAGCCAATGTACGATCCACCCGTGGCACGGGAATCGAC
TGCCAGGAGAACGCCGCCCTTGAACTTGAAGCCCAACGTTGTGGTGCCGT
GATCGAAGTTGATTTTGACGCCGGTCTTGTCGCCATTGGCCTGGATCTGA
TTAAGGTTGTGCAGGGGGTTCTCGAATGGCGGAGCAGCCAGTGTGTAGGG
ATTGGCCAGATTGCACATAAGCCCTTTTTGCTCTTCCTCCACATCCGCCG
ATGACCAGGCATTGGGCCGCATGTACGGAGCATTCGATATCTTGCAGATT
TCAGCTAAAGCCATGTCGACT

BO04163.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG12323-PB 849 Prosbeta5-RB 1..846 864..19 4230 100 Minus
CG12323-PA 849 Prosbeta5-RA 1..846 864..19 4230 100 Minus
CG31742-PA 840 CG31742-RA 478..523 381..336 155 93.4 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 23:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta5-RA 1139 CG12323-RA 96..941 864..19 4230 100 Minus
Prosbeta5-RB 1076 CG12323-RB 33..878 864..19 4230 100 Minus
Prosbeta5R1-RA 1107 CG9868-RA 373..609 574..338 255 74.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 23:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10820282..10820980 717..19 3495 100 Minus
2R 25286936 2R 10820073..10820219 864..718 735 100 Minus
2R 25286936 2R 23309152..23309388 338..574 255 73.8 Plus
2L 23513712 2L 17990976..17991021 381..336 185 93.5 Minus
Blast to na_te.dros performed on 2015-02-12 23:45:45 has no hits.

BO04163.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:55:49 Download gff for BO04163.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12323-PA 1..849 18..864 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:05:25 Download gff for BO04163.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12323-PA 1..849 18..864 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 20:28:17 Download gff for BO04163.3prime
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RB 29..886 10..871 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:36:02 Download gff for BO04163.3prime
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RB 29..886 10..871 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:36:02 Download gff for BO04163.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 10820282..10820988 10..717 99   Minus
2R 10820069..10820219 718..871 97 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 20:28:17 Download gff for BO04163.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6707787..6708493 10..717 99   Minus
arm_2R 6707574..6707724 718..871 97 -> Minus

BO04163.5prime Sequence

866 bp (773 high quality bases) assembled on 2005-12-01

> BO04163.5prime
GAAGTTATCAGTCGACATGGCTTTAGCTGAAATCTGCAAGATATCGAATG
CTCCGTACATGCGGCCCAATGCCTGGTCATCGGCGGATGTGGAGGAAGAG
CAAAAAGGGCTTATGTGCAATCTGGCCAATCCCTACACACTGGCTGCTCC
GCCATTCGAGAACCCCCTGCACAACCTTAATCAGATCCAGGCCAATGGCG
ACAAGACCGGCGTCAAAATCAACTTCGATCACGGCACCACAACGTTGGGC
TTCAAGTTCAAGGGCGGCGTTCTCCTGGCAGTCGATTCCCGTGCCACGGG
TGGATCGTACATTGGCTCCCAGTCGATGAAGAAGATCGTGGAGATCAATC
AGTTCATGCTGGGCACCTTGGCCGGTGGCGCAGCCGATTGCGTTTACTGG
GACAGGGTCCTTTCGAAGGAATGCCGCCTTCACGAGCTTCGAAACAAGGA
ACGCATCTCGGTGGCCGCCGCCAGCAAGATAATGGCCAACATTGCCCACG
AATACAAGGGAATGGGTCTGAGCATGGGCATGATGCTGGCCGGTTACGAT
AAGCGTGGTCCAGGCCTCTACTATGTGGACTCCGAGGGATCTCGCACGCC
TGGCAATTTGTTCTCTGTTGGTAGTGGATCGCTGTACGCCTACGGTGTCC
TGGACTCTGGCTATCATTGGGACCTGGAGGACAAGGAGGCCCAGGAGCTG
GGACGTCGCGCCATCTACCATGCCACCTTCAGGGATGCCTACTCCGGTGG
TATCATTCGCGTGTATCACATTAAGGAGGACGGCTGGGTAAACATCTCCA
ACACCGACTGCATGGAGCTGCACTACATGTACCAGGAGCAGTTGAAGCAG
CAGGCCGCTAAAGCAA

BO04163.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 11:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG12323-PB 849 Prosbeta5-RB 1..845 17..861 4225 100 Plus
CG12323-PA 849 Prosbeta5-RA 1..845 17..861 4225 100 Plus
CG31742-PA 840 CG31742-RA 478..523 500..545 155 93.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta5-RA 1139 CG12323-RA 96..940 17..861 4225 100 Plus
Prosbeta5-RB 1076 CG12323-RB 33..877 17..861 4225 100 Plus
Prosbeta5R1-RA 1107 CG9868-RA 373..609 307..543 255 74.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10820282..10820979 164..861 3490 100 Plus
2R 25286936 2R 10820073..10820219 17..163 735 100 Plus
2R 25286936 2R 23309152..23309388 543..307 255 73.8 Minus
2L 23513712 2L 17990976..17991021 500..545 185 93.5 Plus
Blast to na_te.dros performed on 2015-02-11 15:28:48 has no hits.

BO04163.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:55:50 Download gff for BO04163.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12323-PA 1..846 17..864 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:05:26 Download gff for BO04163.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12323-PA 1..846 17..864 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:32:21 Download gff for BO04163.5prime
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RB 31..878 14..864 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:26:50 Download gff for BO04163.5prime
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RB 31..878 14..864 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:26:50 Download gff for BO04163.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 10820282..10820980 164..864 99   Plus
2R 10820071..10820219 14..163 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:32:21 Download gff for BO04163.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6707787..6708485 164..864 99   Plus
arm_2R 6707576..6707724 14..163 99 -> Plus

BO04163.complete Sequence

880 bp (880 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629654

> BO04163.complete
GAAGTTATCAGTCGACATGGCTTTAGCTGAAATCTGCAAGATATCGAATG
CTCCGTACATGCGGCCCAATGCCTGGTCATCGGCGGATGTGGAGGAAGAG
CAAAAAGGGCTTATGTGCAATCTGGCCAATCCCTACACACTGGCTGCTCC
GCCATTCGAGAACCCCCTGCACAACCTTAATCAGATCCAGGCCAATGGCG
ACAAGACCGGCGTCAAAATCAACTTCGATCACGGCACCACAACGTTGGGC
TTCAAGTTCAAGGGCGGCGTTCTCCTGGCAGTCGATTCCCGTGCCACGGG
TGGATCGTACATTGGCTCCCAGTCGATGAAGAAGATCGTGGAGATCAATC
AGTTCATGCTGGGCACCTTGGCCGGTGGCGCAGCCGATTGCGTTTACTGG
GACAGGGTCCTTTCGAAGGAATGCCGCCTTCACGAGCTTCGAAACAAGGA
ACGCATCTCGGTGGCCGCCGCCAGCAAGATAATGGCCAACATTGCCCACG
AATACAAGGGAATGGGTCTGAGCATGGGCATGATGCTGGCCGGTTACGAT
AAGCGTGGTCCAGGCCTCTACTATGTGGACTCCGAGGGATCTCGCACGCC
TGGCAATTTGTTCTCTGTTGGTAGTGGATCGCTGTACGCCTACGGTGTCC
TGGACTCTGGCTATCATTGGGACCTGGAGGACAAGGAGGCCCAGGAGCTG
GGACGTCGCGCCATCTACCATGCCACCTTCAGGGATGCCTACTCCGGTGG
TATCATTCGCGTGTATCACATTAAGGAGGACGGCTGGGTAAACATCTCCA
ACACCGACTGCATGGAGCTGCACTACATGTACCAGGAGCAGTTGAAGCAG
CAGGCCGCTAAGGCAAGCTTTCTAGACCAT

BO04163.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta5-RA 849 CG12323-PA 1..846 17..862 4230 100 Plus
Prosbeta5-RB 849 CG12323-PB 1..846 17..862 4230 100 Plus
Prosbeta5R1-RA 948 CG9868-PA 285..521 307..543 255 73.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta5-RA 1139 CG12323-RA 96..941 17..862 4230 100 Plus
Prosbeta5-RB 1076 CG12323-RB 33..878 17..862 4230 100 Plus
Prosbeta5R1-RA 1107 CG9868-RA 373..609 307..543 255 73.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10820282..10820980 164..862 3495 100 Plus
2R 25286936 2R 10820073..10820219 17..163 735 100 Plus
2R 25286936 2R 23309152..23309388 543..307 255 73.8 Minus
2L 23513712 2L 17990976..17991021 500..545 185 93.5 Plus
Blast to na_te.dros performed on 2014-11-27 08:17:19 has no hits.

BO04163.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:42:16 Download gff for BO04163.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RA 1..849 17..863 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:12:08 Download gff for BO04163.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RA 91..946 14..871 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:30:15 Download gff for BO04163.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RB 33..878 17..864 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:42:16 Download gff for BO04163.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RA 91..946 14..871 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:14:59 Download gff for BO04163.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5-RB 33..878 17..864 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:14:59 Download gff for BO04163.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10820282..10820980 164..864 99   Plus
2R 10820073..10820219 17..163 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:30:15 Download gff for BO04163.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6707787..6708485 164..864 99   Plus
arm_2R 6707578..6707724 17..163 100 -> Plus

BO04163.pep Sequence

Translation from 16 to 880

> BO04163.pep
MALAEICKISNAPYMRPNAWSSADVEEEQKGLMCNLANPYTLAAPPFENP
LHNLNQIQANGDKTGVKINFDHGTTTLGFKFKGGVLLAVDSRATGGSYIG
SQSMKKIVEINQFMLGTLAGGAADCVYWDRVLSKECRLHELRNKERISVA
AASKIMANIAHEYKGMGLSMGMMLAGYDKRGPGLYYVDSEGSRTPGNLFS
VGSGSLYAYGVLDSGYHWDLEDKEAQELGRRAIYHATFRDAYSGGIIRVY
HIKEDGWVNISNTDCMELHYMYQEQLKQQAAKASFLDH

BO04163.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta5-PA 282 CG12323-PA 1..282 1..282 1493 100 Plus
Prosbeta5-PB 282 CG12323-PB 1..282 1..282 1493 100 Plus
Prosbeta5R1-PA 315 CG9868-PA 1..270 1..272 882 61.2 Plus
Prosbeta5R2-PB 279 CG31742-PB 1..277 1..279 775 51.8 Plus
Prosbeta5R2-PA 279 CG31742-PA 1..277 1..279 775 51.8 Plus