Clone BO04277 Report

Search the DGRC for BO04277

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:42
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptRep-RA
Protein status:BO04277.pep: validated full length
Sequenced Size:1567

Clone Sequence Records

BO04277.3prime Sequence

917 bp (771 high quality bases) assembled on 2005-12-01

> BO04277.3prime
ATGGTCTAGAAAGCTTGCCTCTTGTATATCCATTTCCTGAGTTGCCTGCT
GCATGTCGTGCAATTGTGCCCGCAAATCTTCGGGCAAAGTGTGCTCGTTC
AAGGCACTAGGGTCTTCACCATCCACGACAATCTCCTCTGGATCTGGGGC
TCGTGGCAAAAAGTCGGCATCTGGGAACATTTTGCCAAATATGTCGCGAG
CATTGGCAATGGCCGCGTCATAATCCAGCTCGTAGGTAGGTGGATCGGTG
TAGTAAATATGCTCGGCAGCGGGACTTTTACTAGACTGGGCAGCAATTGT
GAAGTATGAGCTAAATATTATTTGTGCGTCTGATTGATCGAAGAGTTGGC
TAGTGAAAATGGCTAGATCAGACGCTGGATCCTCGCTCAACGCTGGCGTG
GTCAGATGGAAGATATATAAACCCTCGGGACAGGCTCCCGTGTAGTGCGA
CAGTTGTATTAGGAAGGCTTCCCGTCCACCTTCATTGTCAAGTAGTCGAA
GAAGATTTACACCACCACCTCCCTTGTTCAGCTCCTCATTGCCCAGGGGA
CTGGACGATATGAACAAGCCACGTGAGATGTGCGGCTTCAACTCGATGCC
CTTTGAAACTGGTGTATAGCCAGGGGCAGAGACCACATTCTTGGCACGCA
AAGTTTTCCCTGCGCTGCTCAGCAGGAACTCATTCGAATTGGAATCTAAG
GCAATGTCGTCAACGGCTCGCTTTAGGCAGTAAATGCCACCATAAACAGC
GCACAAACGGCAGAAGCACTGCGGCAATTCCCCGCAGCCATACATGGGAA
AGAGAAAGGGTGTGTTGCCATAGCGGCCCAGACTGCCCAGAAATCGTTGT
GTGCGCTGCATACCCTCCTCGAAGCTGGTGCTGGGGGCGCACATGGCAAT
GGCCTGCATCACGCACG

BO04277.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG8432-PA 1536 Rep-RA 635..1533 917..19 4470 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
Rep-RA 1923 CG8432-RA 772..1670 917..19 4480 99.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 04:43:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19492917..19493417 917..417 2490 99.8 Minus
2R 25286936 2R 19493475..19493872 416..19 1990 100 Minus
Blast to na_te.dros performed on 2015-02-11 04:43:30 has no hits.

BO04277.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:58:44 Download gff for BO04277.3prime
Subject Subject Range Query Range Percent Splice Strand
Rep-PA 635..1536 18..917 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:09:50 Download gff for BO04277.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8432-PA 635..1536 18..917 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-23 06:12:25 Download gff for BO04277.3prime
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 772..1670 19..917 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 09:19:29 Download gff for BO04277.3prime
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 772..1670 19..917 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 09:19:29 Download gff for BO04277.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 19493475..19493872 19..416 100   Minus
2R 19492917..19493417 417..917 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-23 06:12:25 Download gff for BO04277.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15380980..15381377 19..416 100   Minus
arm_2R 15380422..15380922 417..917 99 -> Minus

BO04277.5prime Sequence

923 bp (782 high quality bases) assembled on 2005-11-29

> BO04277.5prime
GAAGTTATCAGTCGACATGTTGGATGACCTGCCGGAGCAGTTTGACCTGG
TCGTCATAGGCACAGGCTTCACCGAGTCCTGCATCGCCGCTGCGGGCAGC
AGGATAGGCAAATCGGTGCTCCACCTGGATAGTAATGAGTACTACGGGGA
TGTTTGGAGCTCCTTCTCTATGGATGCTCTATGTGCCCGCTTGGACCAGG
AAGTCGAGCCTCATTCTGCATTGCGAAACGCAAGGTACACCTGGCATTCC
ATGGAAAAAGAATCAGAAACAGATGCACAATCCTGGAATAGGGACTCAGT
GCTGGCCAAGTCGCGACGCTTCAGCTTGGATCTATGCCCGCGCATTTTAT
ACGCAGCCGGGGAGCTGGTGCAGTTGCTCATCAAGTCGAACATCTGCCGC
TATGCTGAATTCCGAGCCGTGGACCATGTGTGCATGCGCCACAATGGTGA
AATTGTGTCCGTGCCCTGCTCCCGTAGCGATGTCTTCAACACCAAAACAC
TGACCATCGTGGAAAAGCGCTTGCTGATGAAATTTCTCACCGCCTGCAAC
GATTACGGCGAGGACAAGTGCAACGAGGACTCGTTGGAATTCCGGGGACG
AACGTTTCTGGAATATTTGCAGGCGCAGCGGGTGACCGAAAAGATATCGT
CGTGCGTGATGCAGGCCATTGCCATGTGCGGCCCCAGCACCAGCTTCGAG
GAGGGTATGCAGCGCACACAACGATTTCTGGGCAGTCTGGGCCGCTATGG
CAACACACCCTTTCTCTTTCCCATGTATGGCTGCGGGGAATTGCCGCAGT
GCTTCTGCCGTTTGTGCGCTGTTTATGGGGGCATTTACTGCCTAAAGCGA
GCCGTTGACGACATTGCCTTAGATTCCAATCGAATGAGTTCCTGCTGAGC
AGCGCAGGGAAAACTTTGCGTGG

BO04277.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG8432-PA 1536 Rep-RA 1..864 17..880 4295 99.8 Plus
CG8432-PA 1536 Rep-RA 865..907 880..922 215 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
Rep-RA 1923 CG8432-RA 136..1044 15..922 4505 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19492329..19493189 63..922 4240 99.8 Plus
2R 25286936 2R 19492222..19492273 15..66 260 100 Plus
Blast to na_te.dros performed on 2015-02-13 01:58:00 has no hits.

BO04277.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 01:58:45 Download gff for BO04277.5prime
Subject Subject Range Query Range Percent Splice Strand
Rep-PA 1..907 17..923 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:09:51 Download gff for BO04277.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8432-PA 1..907 17..923 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:33:42 Download gff for BO04277.5prime
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 136..1044 15..923 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:33:37 Download gff for BO04277.5prime
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 136..1044 15..923 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:33:37 Download gff for BO04277.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 19492332..19493189 66..923 99   Plus
2R 19492222..19492272 15..65 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:33:42 Download gff for BO04277.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15379837..15380694 66..923 99   Plus
arm_2R 15379727..15379777 15..65 100 -> Plus

BO04277.complete Sequence

1567 bp (1567 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629715

> BO04277.complete
GAAGTTATCAGTCGACATGTTGGATGACCTGCCGGAGCAGTTTGACCTGG
TCGTCATAGGCACAGGCTTCACCGAGTCCTGCATCGCCGCTGCGGGCAGC
AGGATAGGCAAATCGGTGCTCCACCTGGATAGTAATGAGTACTACGGGGA
TGTTTGGAGCTCCTTCTCTATGGATGCTCTATGTGCCCGCTTGGACCAGG
AAGTCGAGCCTCATTCTGCATTGCGAAACGCAAGGTACACCTGGCATTCC
ATGGAAAAAGAATCAGAAACAGATGCACAATCCTGGAATAGGGACTCAGT
GCTGGCCAAGTCGCGACGCTTCAGCTTGGATCTATGCCCGCGCATTTTAT
ACGCAGCCGGGGAGCTGGTGCAGTTGCTCATCAAGTCGAACATCTGCCGC
TATGCTGAATTCCGAGCCGTGGACCATGTGTGCATGCGCCACAATGGTGA
AATTGTGTCCGTGCCCTGCTCCCGTAGCGATGTCTTCAACACCAAAACAC
TGACCATCGTGGAAAAGCGCTTGCTGATGAAATTTCTCACCGCCTGCAAC
GATTACGGCGAGGACAAGTGCAACGAGGACTCGTTGGAATTCCGGGGACG
AACGTTTCTGGAATATTTGCAGGCGCAGCGGGTGACCGAAAAGATATCGT
CGTGCGTGATGCAGGCCATTGCCATGTGCGGCCCCAGCACCAGCTTCGAG
GAGGGTATGCAGCGCACACAACGATTTCTGGGCAGTCTGGGCCGCTATGG
CAACACACCCTTTCTCTTTCCCATGTATGGCTGCGGGGAATTGCCGCAGT
GCTTCTGCCGTTTGTGCGCTGTTTATGGTGGCATTTACTGCCTAAAGCGA
GCCGTTGACGACATTGCCTTAGATTCCAATTCGAATGAGTTCCTGCTGAG
CAGCGCAGGGAAAACTTTGCGTGCCAAGAATGTGGTCTCTGCCCCTGGCT
ATACACCAGTTTCAAAGGGCATCGAGTTGAAGCCGCACATCTCACGTGGC
TTGTTCATATCGTCCAGTCCCCTGGGCAATGAGGAGCTGAACAAGGGAGG
TGGTGGTGTAAATCTTCTTCGACTACTTGACAATGAAGGTGGACGGGAAG
CCTTCCTAATACAACTGTCGCACTACACGGGAGCCTGTCCCGAGGGTTTA
TATATCTTCCATCTGACCACGCCAGCGTTGAGCGAGGATCCAGCGTCTGA
TCTAGCCATTTTCACTAGCCAACTCTTCGATCAATCAGACGCACAAATAA
TATTTAGCTCATACTTCACAATTGCTGCCCAGTCTAGTAAAAGTCCCGCT
GCCGAGCATATTTACTACACCGATCCACCTACCTACGAGCTGGATTATGA
CGCGGCCATTGCCAATGCTCGCGACATATTTGGCAAAATGTTCCCAGATG
CCGACTTTTTGCCACGAGCCCCAGATCCAGAGGAGATTGTCGTGGATGGT
GAAGACCCTAGTGCCTTGAACGAGCACACTTTGCCCGAAGATTTGCGGGC
ACAATTGCACGACATGCAGCAGGCAACTCAGGAAATGGATATACAAGAGG
CAAGCTTTCTAGACCAT

BO04277.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:31:35
Subject Length Description Subject Range Query Range Score Percent Strand
Rep-RA 1536 CG8432-PA 1..1533 17..1549 7665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:31:36
Subject Length Description Subject Range Query Range Score Percent Strand
Rep-RA 1923 CG8432-RA 136..1670 15..1549 7675 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:31:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19492329..19493417 63..1151 5445 100 Plus
2R 25286936 2R 19493475..19493872 1152..1549 1990 100 Plus
2R 25286936 2R 19492222..19492273 15..66 260 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:31:35 has no hits.

BO04277.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:41:43 Download gff for BO04277.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 1..1536 17..1550 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:11:27 Download gff for BO04277.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 132..1666 15..1549 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:42:29 Download gff for BO04277.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 143..1670 22..1551 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:41:43 Download gff for BO04277.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 132..1666 15..1549 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:10:01 Download gff for BO04277.complete
Subject Subject Range Query Range Percent Splice Strand
Rep-RA 143..1670 22..1551 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:10:01 Download gff for BO04277.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19493475..19493872 1152..1551 99   Plus
2R 19492332..19493417 66..1151 100 -> Plus
2R 19492229..19492272 22..65 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:42:29 Download gff for BO04277.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15380980..15381377 1152..1551 99   Plus
arm_2R 15379837..15380922 66..1151 100 -> Plus
arm_2R 15379734..15379777 22..65 100 -> Plus

BO04277.pep Sequence

Translation from 16 to 1567

> BO04277.pep
MLDDLPEQFDLVVIGTGFTESCIAAAGSRIGKSVLHLDSNEYYGDVWSSF
SMDALCARLDQEVEPHSALRNARYTWHSMEKESETDAQSWNRDSVLAKSR
RFSLDLCPRILYAAGELVQLLIKSNICRYAEFRAVDHVCMRHNGEIVSVP
CSRSDVFNTKTLTIVEKRLLMKFLTACNDYGEDKCNEDSLEFRGRTFLEY
LQAQRVTEKISSCVMQAIAMCGPSTSFEEGMQRTQRFLGSLGRYGNTPFL
FPMYGCGELPQCFCRLCAVYGGIYCLKRAVDDIALDSNSNEFLLSSAGKT
LRAKNVVSAPGYTPVSKGIELKPHISRGLFISSSPLGNEELNKGGGGVNL
LRLLDNEGGREAFLIQLSHYTGACPEGLYIFHLTTPALSEDPASDLAIFT
SQLFDQSDAQIIFSSYFTIAAQSSKSPAAEHIYYTDPPTYELDYDAAIAN
ARDIFGKMFPDADFLPRAPDPEEIVVDGEDPSALNEHTLPEDLRAQLHDM
QQATQEMDIQEASFLDH

BO04277.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
Rep-PA 511 CG8432-PA 1..511 1..511 2678 100 Plus
Gdi-PC 443 CG4422-PC 3..366 7..396 351 26.1 Plus
Gdi-PB 443 CG4422-PB 3..366 7..396 351 26.1 Plus
Gdi-PA 443 CG4422-PA 3..366 7..396 351 26.1 Plus