Clone BO04343 Report

Search the DGRC for BO04343

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:43
Well:43
Vector:pDNR-Dual
Associated Gene/TranscriptRpL19-RA
Protein status:BO04343.pep: validated full length
Sequenced Size:643

Clone Sequence Records

BO04343.3prime Sequence

641 bp (640 high quality bases) assembled on 2005-12-01

> BO04343.3prime
ATGGTCTAGAAAGCTTGCGTGACCCGCGGTGGCGGCCTTGGCAGCGATCT
CGTCCTCCTTAGCATGCAGGGCGATGAGCTCCTGCTTCTTGGTGGCAATA
CGCTCCTCGCGGCGCTTGCGGGCCTCACGCACCTTCTGTCGGCGAGCCTC
GGCCTGATCAGCCAGCATCTTGCTGCGCTGCTTCTCAGCCTTCTTCTTGT
GGATGTACTCCATGAGGACGCGCTTGTTCTTGAATACGTTACCCTTGCAC
TTCATGTACAGGTCGTGGTACAGGTGCCTGTCAATCTTCTTGCTGTCGCG
GTACTTCTTCAACAGGCGGCGCAGAACGCGCTGGCGCTGCATCCACAGCA
GCTTGGTAGGCATGCGGGCGTTCGCAGTACCCTTACGCTTTCCGAATCCG
CAGTGACGTCCCTTGCGGCGGGCCTCGGTGTTTTTGCGCACACGGTAACG
GGAGTGGACCACGACGGGCTTCTTGATGATCAGACCATCCTTGATAAGCT
TGCGAATGTTCTGACGCGAGTTTGTGTTAGCGATCTCGTTGATTTCATTG
GGATCCAACCAGACCTTCTTCTTGCCGCATCGCAGCACGGAGGCTGCGAG
CCTCTTCTGGAGCTTTAGAGAACTCATGTCGACTGATAACT

BO04343.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:03:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG2746-PA 612 RpL19-RA 1..609 627..19 3045 100 Minus
CG2746-PB 612 RpL19-RB 1..609 627..19 3045 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:01:35
Subject Length Description Subject Range Query Range Score Percent Strand
RpL19-RB 755 CG2746-RB 36..645 628..19 3050 100 Minus
RpL19-RA 1361 CG2746-RA 74..683 628..19 3050 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 02:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24968555..24969051 19..515 2485 100 Plus
2R 25286936 2R 24969116..24969226 514..624 555 100 Plus
Blast to na_te.dros performed on 2015-02-13 02:01:32 has no hits.

BO04343.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:00:29 Download gff for BO04343.3prime
Subject Subject Range Query Range Percent Splice Strand
RpL19-PA 1..612 15..627 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:12:24 Download gff for BO04343.3prime
Subject Subject Range Query Range Percent Splice Strand
CG2746-PB 1..612 15..627 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:34:02 Download gff for BO04343.3prime
Subject Subject Range Query Range Percent Splice Strand
RpL19-RA 67..692 9..636 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:31:04 Download gff for BO04343.3prime
Subject Subject Range Query Range Percent Splice Strand
RpL19-RA 67..692 9..636 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:31:04 Download gff for BO04343.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 24969118..24969224 516..622 100 <- Plus
2R 24968546..24969051 9..515 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:34:02 Download gff for BO04343.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20856641..20856747 516..622 100 <- Plus
arm_2R 20856069..20856574 9..515 99 <- Plus

BO04343.5prime Sequence

641 bp (640 high quality bases) assembled on 2005-11-29

> BO04343.5prime
GAAGTTATCAGTCGACATGAGTTCTCTAAAGCTCCAGAAGAGGCTCGCAG
CCTCCGTGCTGCGATGCGGCAAGAAGAAGGTCTGGTTGGATCCCAATGAA
ATCAACGAGATCGCTAACACAAACTCGCGTCAGAACATTCGCAAGCTTAT
CAAGGATGGTCTGATCATCAAGAAGCCCGTCGTGGTCCACTCCCGTTACC
GTGTGCGCAAAAACACCGAGGCCCGCCGCAAGGGACGTCACTGCGGATTC
GGAAAGCGTAAGGGTACTGCGAACGCCCGCATGCCTACCAAGCTGCTGTG
GATGCAGCGCCAGCGCGTTCTGCGCCGCCTGTTGAAGAAGTACCGCGACA
GCAAGAAGATTGACAGGCACCTGTACCACGACCTGTACATGAAGTGCAAG
GGTAACGTATTCAAGAACAAGCGCGTCCTCATGGAGTACATCCACAAGAA
GAAGGCTGAGAAGCAGCGCAGCAAGATGCTGGCTGATCAGGCCGAGGCTC
GCCGACAGAAGGTGCGTGAGGCCCGCAAGCGCCGCGAGGAGCGTATTGCC
ACCAAGAAGCAGGAGCTCATCGCCCTGCATGCTAAGGAGGACGAGATCGC
TGCCAAGGCCGCCACCGCGGGTCACGCAAGCTTTCTAGACC

BO04343.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG2746-PA 612 RpL19-RA 1..609 17..625 3045 100 Plus
CG2746-PB 612 RpL19-RB 1..609 17..625 3045 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
RpL19-RB 755 CG2746-RB 36..645 16..625 3050 100 Plus
RpL19-RA 1361 CG2746-RA 74..683 16..625 3050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24968555..24969051 625..129 2485 100 Minus
2R 25286936 2R 24969116..24969226 130..20 555 100 Minus
Blast to na_te.dros performed on 2015-02-12 16:02:46 has no hits.

BO04343.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:00:30 Download gff for BO04343.5prime
Subject Subject Range Query Range Percent Splice Strand
RpL19-PA 1..612 17..629 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:12:26 Download gff for BO04343.5prime
Subject Subject Range Query Range Percent Splice Strand
CG2746-PB 1..612 17..629 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:28:43 Download gff for BO04343.5prime
Subject Subject Range Query Range Percent Splice Strand
RpL19-RA 67..692 8..635 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:37:57 Download gff for BO04343.5prime
Subject Subject Range Query Range Percent Splice Strand
RpL19-RA 67..692 8..635 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:37:57 Download gff for BO04343.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 24969118..24969224 22..128 100 <- Minus
2R 24968546..24969051 129..635 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:28:43 Download gff for BO04343.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20856641..20856747 22..128 100 <- Minus
arm_2R 20856069..20856574 129..635 99 <- Minus

BO04343.complete Sequence

643 bp (643 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629733

> BO04343.complete
GAAGTTATCAGTCGACATGAGTTCTCTAAAGCTCCAGAAGAGGCTCGCAG
CCTCCGTGCTGCGATGCGGCAAGAAGAAGGTCTGGTTGGATCCCAATGAA
ATCAACGAGATCGCTAACACAAACTCGCGTCAGAACATTCGCAAGCTTAT
CAAGGATGGTCTGATCATCAAGAAGCCCGTCGTGGTCCACTCCCGTTACC
GTGTGCGCAAAAACACCGAGGCCCGCCGCAAGGGACGTCACTGCGGATTC
GGAAAGCGTAAGGGTACTGCGAACGCCCGCATGCCTACCAAGCTGCTGTG
GATGCAGCGCCAGCGCGTTCTGCGCCGCCTGTTGAAGAAGTACCGCGACA
GCAAGAAGATTGACAGGCACCTGTACCACGACCTGTACATGAAGTGCAAG
GGTAACGTATTCAAGAACAAGCGCGTCCTCATGGAGTACATCCACAAGAA
GAAGGCTGAGAAGCAGCGCAGCAAGATGCTGGCTGATCAGGCCGAGGCTC
GCCGACAGAAGGTGCGTGAGGCCCGCAAGCGCCGCGAGGAGCGTATTGCC
ACCAAGAAGCAGGAGCTCATCGCCCTGCATGCTAAGGAGGACGAGATCGC
TGCCAAGGCCGCCACCGCGGGTCACGCAAGCTTTCTAGACCAT

BO04343.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
RpL19-RB 612 CG2746-PB 1..609 17..625 3045 100 Plus
RpL19-RA 612 CG2746-PA 1..609 17..625 3045 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
RpL19-RB 755 CG2746-RB 36..645 16..625 3050 100 Plus
RpL19-RA 1361 CG2746-RA 74..683 16..625 3050 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24968555..24969051 625..129 2485 100 Minus
2R 25286936 2R 24969116..24969226 130..20 555 100 Minus
Blast to na_te.dros performed on 2014-11-27 06:42:35 has no hits.

BO04343.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:41:19 Download gff for BO04343.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RB 1..612 17..629 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:10:59 Download gff for BO04343.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RB 25..650 8..635 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:51:29 Download gff for BO04343.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RA 75..683 17..627 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:41:19 Download gff for BO04343.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RB 25..650 8..635 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:52:17 Download gff for BO04343.complete
Subject Subject Range Query Range Percent Splice Strand
RpL19-RA 75..683 17..627 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:52:17 Download gff for BO04343.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24969118..24969229 17..128 98   Minus
2R 24968553..24969051 129..627 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:51:29 Download gff for BO04343.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20856641..20856752 17..128 98   Minus
arm_2R 20856076..20856574 129..627 99 <- Minus

BO04343.pep Sequence

Translation from 16 to 643

> BO04343.pep
MSSLKLQKRLAASVLRCGKKKVWLDPNEINEIANTNSRQNIRKLIKDGLI
IKKPVVVHSRYRVRKNTEARRKGRHCGFGKRKGTANARMPTKLLWMQRQR
VLRRLLKKYRDSKKIDRHLYHDLYMKCKGNVFKNKRVLMEYIHKKKAEKQ
RSKMLADQAEARRQKVREARKRREERIATKKQELIALHAKEDEIAAKAAT
AGHASFLDH

BO04343.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
RpL19-PB 203 CG2746-PB 1..203 1..203 1037 100 Plus
RpL19-PA 203 CG2746-PA 1..203 1..203 1037 100 Plus