Clone BO04404 Report

Search the DGRC for BO04404

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:44
Well:4
Vector:pDNR-Dual
Associated Gene/Transcriptltd-RC
Protein status:BO04404.pep: validated full length
Sequenced Size:1198

Clone Sequence Records

BO04404.3prime Sequence

896 bp (793 high quality bases) assembled on 2005-12-01

> BO04404.3prime
ATGGTCTAGAAAGCTTGCGCAGGAACACTTGTTCTTGGCATCCGATCCGG
TTGCATCGGCCGCGCTCAAGTTGAACTTGTCGCCATCGGCCAGATCGGCA
GATATCAGCTTATCGTTGATGAGTATCTTATTCACGAGGGCACGAGCTGC
CTCATCGATGTTGATATTCTCCTTGGCGGATGTCTCAAACCAACCGGCAA
ATCCGTTCTCCCTCACATACTCATCCATCTTCTCGGGCTGCGTTATGATG
CCCTGCTTTTCCTGGTCGCATTTATTGGCCAGCAGGATGCACGGAATGGG
ACTGCCGTCCGGCAGCTGCACCTTGGAGTCTAGATCTTCCTTCCACTTGC
TCACGCAATCGAAAGTCCCACTGCGAGTCACATCAAAAACGATGAACGCG
CCCACCGCCTCCTTGTAGTAGACACGGGTCATGTTGCCAAACCTCTCCTG
ACCGGCGATATCCCACAGCTGGAGGCGCACTATCGTATTGGCGTCCCACT
GCAGCACTTTCAGGGCGAAGTCCACGCCGATGGTGGCCCTGTAGTTCTGG
CTGAAGAACTGGTGCACATAGCGCTTAATGAAGGACGTCTTGCCGGTGCC
CAGTTCACCAATGACTAGAATCTTGTACAGATGCTCGCGCTTATCGCTGG
TGGATGTCATGATGGCTCCGTTGTGCAGGTATCCGTTGTTCCTGTTGATG
TCCATGTGGTTACGGTTGACTCCCGCGGGCATGACCGTGGTCAGTTGCAG
CGCCTCTATGGCGCCGAGATCCAACTCCGGCTTGGGCTCGGCGTAGGCCG
GAGAAGCACTTCGCAGCGAGAACTGGGAGGAGCTGAGCGGCGGATGCAGC
TGGGTCTCCGCGGACGGGAAACAGATCTGGCGGCGCACGAAGATGG

BO04404.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG8024-PE 1167 ltd-RE 287..1164 896..19 4390 100 Minus
CG8024-PC 1167 ltd-RC 287..1164 896..19 4390 100 Minus
CG8024-PD 669 ltd-RD 18..666 667..19 3245 100 Minus
CG8024-PA 1158 ltd-RA 508..1155 666..19 3240 100 Minus
CG8024-PB 2061 ltd-RB 1411..2058 666..19 3240 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
ltd-RC 2347 CG8024-RC 897..1774 896..19 4390 100 Minus
ltd-RE 2156 CG8024-RE 706..1583 896..19 4390 100 Minus
ltd-RD 1448 CG8024-RD 227..875 667..19 3245 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 15:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9178830..9179225 271..666 1980 100 Plus
2R 25286936 2R 9185216..9185446 666..896 1155 100 Plus
2R 25286936 2R 9178606..9178749 127..270 720 100 Plus
2R 25286936 2R 9178437..9178546 19..128 550 100 Plus
Blast to na_te.dros performed on 2015-02-13 15:15:06 has no hits.

BO04404.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:02:05 Download gff for BO04404.3prime
Subject Subject Range Query Range Percent Splice Strand
ltd-PC 287..1167 16..896 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:14:51 Download gff for BO04404.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8024-PC 287..1167 16..896 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 11:01:36 Download gff for BO04404.3prime
Subject Subject Range Query Range Percent Splice Strand
ltd-RE 706..1589 12..896 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:47:32 Download gff for BO04404.3prime
Subject Subject Range Query Range Percent Splice Strand
ltd-RE 706..1589 12..896 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:47:32 Download gff for BO04404.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 9185217..9185446 667..896 100   Plus
2R 9178830..9179225 271..666 100 <- Plus
2R 9178606..9178749 127..270 100 <- Plus
2R 9178431..9178544 12..126 96 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 11:01:36 Download gff for BO04404.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5072722..5072951 667..896 100   Plus
arm_2R 5066335..5066730 271..666 100 <- Plus
arm_2R 5066111..5066254 127..270 100 <- Plus
arm_2R 5065936..5066049 12..126 96 <- Plus

BO04404.5prime Sequence

854 bp (744 high quality bases) assembled on 2005-11-29

> BO04404.5prime
GAAGTTATCAGTCGACATGGCAACCGGCGTCATCCAGAGTAGCGTTGTCT
CCACCTCCGCCGGACGCCAGAATATCTGCGACTGCCTGGAACAGGAGTCC
GCCGGATTGGTCAAGGCCCTGCCCAAATCCAAGTCGGCCGATCAGCTCTC
GGAACTCACCTGCGCCTGCCTGCGCTGCCAGTACCTGGCCACGGATCTTC
AGCATCCGAACACCCAGTCCGGTCACCTGCCCGTGGAGCACAGACACCGA
CCCGTGAGCTCAGGCTCCGGTTCACTGGGCGCCCTCAGCGCCAAGGAGTC
GCCCATCTTCGTGCGCCGCCAGATCTGTTTCCCGTCCGCGGAGACCCAGC
TGCATCCGCCGCTCAGCTCCTCCCAGTTCTCGCTGCGAAGTGCTTCTCCG
GCCTACGCCGAGCCCAAGCCGGAGTTGGATCTCGGCGCCATAGAGGCGCT
GCAACTGACCACGGTCATGCCCGCGGGAGTCAACCGTAACCACATGGACA
TCAACAGGAACAACGGATACCTGCACAACGGAGCCATCATGACATCCACC
AGCGATAAGCGCGAGCATCTGTACAAGATTCTAGTCATTGGTGAACTGGG
CACCGGCAAGACGTCCTTCATTAAGCGCTATGTGCACCAGTTCTTCAGCC
AGAACTACAGGGCCACCATCGGCGTGGACTTCGCCCTGAAAGTGCTGCAG
TGGGACGCCAATACGATAGTGCGCCTCCAGCTGTGGGATATCGCCGGTCA
GGAGAGGTTTGGCAACATGACCCGTGTCTACTACAAGGAGGCGGTGGGCG
CGTTCTTCGTTTTTTGATGTGACTCCGCAGTGGGACTTTCGATTGCGTGA
GCAA

BO04404.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:04:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG8024-PE 1167 ltd-RE 1..798 17..814 3965 99.8 Plus
CG8024-PC 1167 ltd-RC 1..798 17..814 3965 99.8 Plus
CG8024-PD 669 ltd-RD 18..300 532..814 1390 99.6 Plus
CG8024-PA 1158 ltd-RA 508..789 533..814 1385 99.6 Plus
CG8024-PB 2061 ltd-RB 1411..1692 533..814 1385 99.6 Plus
CG8024-PD 669 ltd-RD 310..338 826..854 145 100 Plus
CG8024-PE 1167 ltd-RE 808..836 826..854 145 100 Plus
CG8024-PC 1167 ltd-RC 808..836 826..854 145 100 Plus
CG8024-PA 1158 ltd-RA 799..827 826..854 145 100 Plus
CG8024-PB 2061 ltd-RB 1702..1730 826..854 145 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 10:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
ltd-RC 2347 CG8024-RC 610..1446 16..854 4130 99.6 Plus
ltd-RE 2156 CG8024-RE 419..1255 16..854 4130 99.6 Plus
ltd-RD 1448 CG8024-RD 227..547 532..854 1550 99.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 10:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9185216..9185733 533..16 2590 100 Minus
2R 25286936 2R 9178906..9179225 854..533 1495 99.1 Minus
Blast to na_te.dros performed on 2015-02-12 10:05:54 has no hits.

BO04404.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:02:06 Download gff for BO04404.5prime
Subject Subject Range Query Range Percent Splice Strand
ltd-PE 1..834 17..852 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:14:53 Download gff for BO04404.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8024-PE 1..834 17..852 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 20:52:46 Download gff for BO04404.5prime
Subject Subject Range Query Range Percent Splice Strand
ltd-RE 415..1253 11..852 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:04:20 Download gff for BO04404.5prime
Subject Subject Range Query Range Percent Splice Strand
ltd-RE 415..1253 11..852 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:04:20 Download gff for BO04404.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 9185217..9185737 11..532 99   Minus
2R 9178908..9179225 533..852 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 20:52:46 Download gff for BO04404.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5072722..5073242 11..532 99   Minus
arm_2R 5066413..5066730 533..852 99 <- Minus

BO04404.complete Sequence

1198 bp (1198 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629745

> BO04404.complete
GAAGTTATCAGTCGACATGGCAACCGGCGTCATCCAGAGTAGCGTTGTCT
CCACCTCCGCCGGACGCCAGAATATCTGCGACTGCCTGGAACAGGAGTCC
GCCGGATTGGTCAAGGCCCTGCCCAAATCCAAGTCGGCCGATCAGCTCTC
GGAACTCACCTGCGCCTGCCTGCGCTGCCAGTACCTGGCCACGGATCTTC
AGCATCCGAACACCCAGTCCGGTCACCTGCCCGTGGAGCACAGACACCGA
CCCGTGAGCTCAGGCTCCGGTTCACTGGGCGCCCTCAGCGCCAAGGAGTC
GCCCATCTTCGTGCGCCGCCAGATCTGTTTCCCGTCCGCGGAGACCCAGC
TGCATCCGCCGCTCAGCTCCTCCCAGTTCTCGCTGCGAAGTGCTTCTCCG
GCCTACGCCGAGCCCAAGCCGGAGTTGGATCTCGGCGCCATAGAGGCGCT
GCAACTGACCACGGTCATGCCCGCGGGAGTCAACCGTAACCACATGGACA
TCAACAGGAACAACGGATACCTGCACAACGGAGCCATCATGACATCCACC
AGCGATAAGCGCGAGCATCTGTACAAGATTCTAGTCATTGGTGAACTGGG
CACCGGCAAGACGTCCTTCATTAAGCGCTATGTGCACCAGTTCTTCAGCC
AGAACTACAGGGCCACCATCGGCGTGGACTTCGCCCTGAAAGTGCTGCAG
TGGGACGCCAATACGATAGTGCGCCTCCAGCTGTGGGATATCGCCGGTCA
GGAGAGGTTTGGCAACATGACCCGTGTCTACTACAAGGAGGCGGTGGGCG
CGTTCATCGTTTTTGATGTGACTCGCAGTGGGACTTTCGATTGCGTGAGC
AAGTGGAAGGAAGATCTAGACTCCAAGGTGCAGCTGCCGGACGGCAGTCC
CATTCCGTGCATCCTGCTGGCCAATAAATGCGACCAGGAAAAGCAGGGCA
TCATAACGCAGCCCGAGAAGATGGATGAGTATGTGAGGGAGAACGGATTT
GCCGGTTGGTTTGAGACATCCGCCAAGGAGAATATCAACATCGATGAGGC
AGCTCGTGCCCTCGTGAATAAGATACTCATCAACGATAAGCTGATATCTG
CCGATCTGGCCGATGGCGACAAGTTCAACTTGAGCGCGGCCGATGCAACC
GGATCGGATGCCAAGAACAAGTGTTCCTGCGCAAGCTTTCTAGACCAT

BO04404.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:35:55
Subject Length Description Subject Range Query Range Score Percent Strand
ltd-RC 1167 CG8024-PC 1..1164 17..1180 5820 100 Plus
ltd-RE 1167 CG8024-PE 1..1164 17..1180 5820 100 Plus
ltd-RD 669 CG8024-PD 18..666 532..1180 3245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
ltd-RC 2347 CG8024-RC 610..1774 16..1180 5825 100 Plus
ltd-RE 2156 CG8024-RE 419..1583 16..1180 5825 100 Plus
ltd-RD 1448 CG8024-RD 227..875 532..1180 3245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:35:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9185216..9185733 533..16 2590 100 Minus
2R 25286936 2R 9178830..9179225 928..533 1980 100 Minus
2R 25286936 2R 9178606..9178749 1072..929 720 100 Minus
2R 25286936 2R 9178437..9178546 1180..1071 550 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:35:55 has no hits.

BO04404.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:40:58 Download gff for BO04404.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RC 1..1167 17..1183 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:10:32 Download gff for BO04404.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RC 625..1799 11..1187 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:43:28 Download gff for BO04404.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RE 420..1583 17..1182 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:40:58 Download gff for BO04404.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RC 625..1799 11..1187 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:11:48 Download gff for BO04404.complete
Subject Subject Range Query Range Percent Splice Strand
ltd-RE 420..1583 17..1182 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:11:48 Download gff for BO04404.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9185217..9185732 17..532 100   Minus
2R 9178830..9179225 533..928 100 <- Minus
2R 9178606..9178749 929..1072 100 <- Minus
2R 9178433..9178544 1073..1182 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:43:28 Download gff for BO04404.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5072722..5073237 17..532 100   Minus
arm_2R 5066335..5066730 533..928 100 <- Minus
arm_2R 5066111..5066254 929..1072 100 <- Minus
arm_2R 5065938..5066049 1073..1182 98 <- Minus

BO04404.pep Sequence

Translation from 16 to 1198

> BO04404.pep
MATGVIQSSVVSTSAGRQNICDCLEQESAGLVKALPKSKSADQLSELTCA
CLRCQYLATDLQHPNTQSGHLPVEHRHRPVSSGSGSLGALSAKESPIFVR
RQICFPSAETQLHPPLSSSQFSLRSASPAYAEPKPELDLGAIEALQLTTV
MPAGVNRNHMDINRNNGYLHNGAIMTSTSDKREHLYKILVIGELGTGKTS
FIKRYVHQFFSQNYRATIGVDFALKVLQWDANTIVRLQLWDIAGQERFGN
MTRVYYKEAVGAFIVFDVTRSGTFDCVSKWKEDLDSKVQLPDGSPIPCIL
LANKCDQEKQGIITQPEKMDEYVRENGFAGWFETSAKENINIDEAARALV
NKILINDKLISADLADGDKFNLSAADATGSDAKNKCSCASFLDH

BO04404.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:31:19
Subject Length Description Subject Range Query Range Score Percent Strand
ltd-PC 388 CG8024-PC 1..388 1..388 2016 100 Plus
ltd-PE 388 CG8024-PE 1..388 1..388 2016 100 Plus
ltd-PD 222 CG8024-PD 3..222 169..388 1129 98.6 Plus
ltd-PJ 214 CG8024-PJ 1..214 175..388 1118 100 Plus
ltd-PH 214 CG8024-PH 1..214 175..388 1118 100 Plus