Clone BO04448 Report

Search the DGRC for BO04448

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:44
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptAnnIX-RB
Protein status:BO04448.pep: validated full length
Sequenced Size:1006

Clone Sequence Records

BO04448.3prime Sequence

891 bp (844 high quality bases) assembled on 2005-12-01

> BO04448.3prime
ATGGTCTAGAAAGCTTGCGTAGGAGGCCAGGCACTGCAAGACGTAGCTGT
AGTCTCCGGAGAGGTCGTCCTTGATCCAGGACTCCAAGCTCTTGCCGTAC
TTGTTCTGGAATGCCTCCTTGATGTCACCCAGATCGATCTCCGACCGGCT
GACAATGATGCGGATCAGCGTCTTGTCCTTGGTGCCCATGCCGGCCATTG
AGTCGTGCAGGCGCTCCGAAAAGTAGTCGATCTTGGACTTGCAGCACTTG
ACGATGGCCAGGAAACCCTTCTCCACGGAGCCGCTAAACTCCCGCTTGAT
GGCCTTCTCGATGTCGTTGCCCGACAGATTCTCGTATTCGAGGAAGATCT
GGCGCAGCTGCTGGTAGGAGCGGGTGATCAGGATCGAGTTGAAGGTGGAC
TCATCTGTGCCCCACTGTCCCTCGCCGGCGTCGTGCAGAGCCTGGGCATC
GGCGATGGCCGCGGCCTCGTCCACGCCCTGGTTCTCATCCCGGTTGCCCT
GGACGAGCGAGACACACAGCCGCTTGAAGTGGCCACTGGTGTCGCCCTTC
AGGTCGGACTCTAGGGACTTGCCGAAGCTCTGCTCGTAGAACTGGGCAAT
GGTCTTGATGCCGTAGTTGGACAGCGTGCAGAGGATCTCGATGATGGCCT
CCTCGTCGGTTCCCAGTCCCGAGATGGCGTCGTGCAGCTCCTGGGCATAG
AACTGGGGCAGCGGCGTCATCAGAGCCAGGATAACATCCTCGAATTTGCC
GCCCAGTTCGGACTTGAGGTCCGAGATCAGGTCCTTGCCGTACGAGGTCT
TGAACGCCTCAGCGATCTCCAAACGCTGGACGATGCCACGCCTGGCCAGG
ATCTCCATGATGGCCTTCTCGTCGGTGCCGAAGCCTTTCAT

BO04448.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG5730-PD 975 AnnIX-RD 100..972 891..19 4340 99.8 Minus
CG5730-PB 975 AnnIX-RB 100..972 891..19 4340 99.8 Minus
CG5730-PA 975 AnnIX-RA 100..923 891..68 4095 99.8 Minus
CG5730-PC 975 AnnIX-RC 100..922 891..69 4090 99.8 Minus
CG9968-PA 969 Anxb11-RA 307..357 666..616 180 94.1 Minus
CG9968-PB 1536 Anxb11-RB 874..924 666..616 180 94.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB9-RB 1184 CG5730-RB 169..1041 891..19 4350 99.9 Minus
AnxB9-RD 1300 CG5730-RD 285..1157 891..19 4350 99.9 Minus
AnxB9-RF 1457 CG5730-RF 194..1020 891..65 4105 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:04:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21068138..21068777 891..252 3185 99.8 Minus
3R 32079331 3R 21068837..21069020 252..69 920 100 Minus
3R 32079331 3R 21070722..21070774 71..19 265 100 Minus
X 23542271 X 16418705..16418779 616..690 225 86.7 Plus
Blast to na_te.dros performed on 2015-02-12 16:04:21 has no hits.

BO04448.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:03:12 Download gff for BO04448.3prime
Subject Subject Range Query Range Percent Splice Strand
AnnIX-PD 100..975 15..891 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:16:26 Download gff for BO04448.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5730-PB 100..975 15..891 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:29:08 Download gff for BO04448.3prime
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RD 285..1167 9..891 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:39:54 Download gff for BO04448.3prime
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RD 285..1167 9..891 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:39:54 Download gff for BO04448.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 21070724..21070784 9..69 93   Minus
3R 21068838..21069019 70..251 100 -> Minus
3R 21068138..21068777 252..891 99 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:29:08 Download gff for BO04448.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16896446..16896506 9..69 93   Minus
arm_3R 16894560..16894741 70..251 100 -> Minus
arm_3R 16893860..16894499 252..891 99 -> Minus

BO04448.5prime Sequence

805 bp (733 high quality bases) assembled on 2005-11-29

> BO04448.5prime
GAAGTTATCAGTCGACATGAGTTCCGCTGAGTACTACCCATTCAAGTGCA
CACCCACTGTCTACCCGGCGGATCCCTTCGATCCCGTCGAGGATGCGGCT
ATTCTGCGCAAGGCGATGAAAGGCTTCGGCACCGACGAGAAGGCCATCAT
CGAGATCCTGGCCAGGCGTGGCATCGTCCAGCGTTTGGAGATCGCTGAGG
CGTTCAAGACCTCGTACGGCAAGGACCTGATCTCGGACCTCAAGTCCGAA
CTGGGCGGCAAATTCGAGGATGTTATCCTGGCTCTGATGACGCCGCTGCC
CCAGTTCTATGCCCAGGAGCTGCACGACGCCATCTCGGGACTGGGAACCG
ACGAGGAGGCCATCATCGAGATCCTCTGCACGCTGTCCAACTACGGCATC
AAGACCATTGCCCAGTTCTACGAGCAGAGCTTCGGCAAGTCCCTAGAGTC
CGACCTGAAGGGCGACACCAGTGGCCACTTCAAGCGGCTGTGTGTCTCGC
TCGTCCAGGGCAACCGGGATGAGAACCAGGGCGTGGACGAGGCCGCGGCC
ATCGCCGATGCCCAGGCTCTGCACGACGCCGGCGAGGGACAGTGGGGCAC
AGATGAGTCCACCTTCAACTCGATCCTGATCACCCGCTCCTACCAGCAGC
TGCGCCAGATCTTCCTCGAATACGAGAATCTGTCGGGCAACGACATCGAG
AAGGCCATCAAGCGGGAGTTTAGCGGCTCCGTGGAGAAGGGTTTCCTGGC
CATCGTCAAGTGCTGCAAGTCCAAGATCGACTACTTTTCGGAGCGCCTGC
ACGAC

BO04448.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG5730-PD 975 AnnIX-RD 1..789 17..805 3945 100 Plus
CG5730-PA 975 AnnIX-RA 1..789 17..805 3945 100 Plus
CG5730-PB 975 AnnIX-RB 1..789 17..805 3945 100 Plus
CG5730-PC 975 AnnIX-RC 1..789 17..805 3945 100 Plus
CG9968-PA 969 Anxb11-RA 307..357 341..391 180 94.1 Plus
CG9968-PB 1536 Anxb11-RB 874..924 341..391 180 94.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB9-RF 1457 CG5730-RF 95..883 17..805 3945 100 Plus
AnxB9-RE 1456 CG5730-RE 94..882 17..805 3945 100 Plus
AnxB9-RC 1432 CG5730-RC 70..858 17..805 3945 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 23:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21068067..21068777 45..755 3555 100 Plus
3R 32079331 3R 21068837..21068887 755..805 255 100 Plus
X 23542271 X 16418705..16418779 391..317 225 86.7 Minus
Blast to na_te.dros performed on 2015-02-11 23:40:58 has no hits.

BO04448.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:03:13 Download gff for BO04448.5prime
Subject Subject Range Query Range Percent Splice Strand
AnnIX-PC 1..789 17..805 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:16:27 Download gff for BO04448.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5730-PC 1..789 17..805 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 02:36:20 Download gff for BO04448.5prime
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RC 62..858 9..805 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:52:42 Download gff for BO04448.5prime
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RC 62..858 9..805 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 01:52:42 Download gff for BO04448.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 21068838..21068887 756..805 100   Plus
3R 21068069..21068777 47..755 100 -> Plus
3R 21067462..21067499 9..46 92 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 02:36:20 Download gff for BO04448.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16894560..16894609 756..805 100   Plus
arm_3R 16893791..16894499 47..755 100 -> Plus
arm_3R 16893184..16893221 9..46 92 -> Plus

BO04448.complete Sequence

1006 bp (1006 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629768

> BO04448.complete
GAAGTTATCAGTCGACATGAGTTCCGCTGAGTACTACCCATTCAAGTGCA
CACCCACTGTCTACCCGGCGGATCCCTTCGATCCCGTCGAGGATGCGGCT
ATTCTGCGCAAGGCGATGAAAGGCTTCGGCACCGACGAGAAGGCCATCAT
CGAGATCCTGGCCAGGCGTGGCATCGTCCAGCGTTTGGAGATCGCTGAGG
CGTTCAAGACCTCGTACGGCAAGGACCTGATCTCGGACCTCAAGTCCGAA
CTGGGCGGCAAATTCGAGGATGTTATCCTGGCTCTGATGACGCCGCTGCC
CCAGTTCTATGCCCAGGAGCTGCACGACGCCATCTCGGGACTGGGAACCG
ACGAGGAGGCCATCATCGAGATCCTCTGCACGCTGTCCAACTACGGCATC
AAGACCATTGCCCAGTTCTACGAGCAGAGCTTCGGCAAGTCCCTAGAGTC
CGACCTGAAGGGCGACACCAGTGGCCACTTCAAGCGGCTGTGTGTCTCGC
TCGTCCAGGGCAACCGGGATGAGAACCAGGGCGTGGACGAGGCCGCGGCC
ATCGCCGATGCCCAGGCTCTGCACGACGCCGGCGAGGGACAGTGGGGCAC
AGATGAGTCCACCTTCAACTCGATCCTGATCACCCGCTCCTACCAGCAGC
TGCGCCAGATCTTCCTCGAATACGAGAATCTGTCGGGCAACGACATCGAG
AAGGCCATCAAGCGGGAGTTTAGCGGCTCCGTGGAGAAGGGTTTCCTGGC
CATCGTCAAGTGCTGCAAGTCCAAGATCGACTACTTTTCGGAGCGCCTGC
ACGACTCAATGGCCGGCATGGGCACCAAGGACAAGACGCTGATCCGCATC
ATTGTCAGCCGGTCGGAGATCGATCTGGGTGACATCAAGGAGGCATTCCA
GAACAAGTACGGCAAGAGCTTGGAGTCCTGGATCAAGGACGACCTCTCCG
GAGACTACAGCTACGTCTTGCAGTGCCTGGCCTCCTACGCAAGCTTTCTA
GACCAT

BO04448.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB9-RB 975 CG5730-PB 1..972 17..988 4860 100 Plus
AnxB9-RD 975 CG5730-PD 1..972 17..988 4860 100 Plus
AnxB9-RF 975 CG5730-PF 1..926 17..942 4615 99.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB9-RB 1184 CG5730-RB 70..1041 17..988 4860 100 Plus
AnxB9-RD 1300 CG5730-RD 186..1157 17..988 4860 100 Plus
AnxB9-RF 1457 CG5730-RF 95..1020 17..942 4615 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:32:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21068067..21068777 45..755 3555 100 Plus
3R 32079331 3R 21068837..21069020 755..938 920 100 Plus
3R 32079331 3R 21070722..21070774 936..988 265 100 Plus
X 23542271 X 16418705..16418779 391..317 225 86.7 Minus
Blast to na_te.dros performed on 2014-11-27 01:32:48 has no hits.

BO04448.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:40:56 Download gff for BO04448.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RB 1..975 17..992 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:10:30 Download gff for BO04448.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RB 74..1063 9..998 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:56:30 Download gff for BO04448.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RD 186..1157 17..990 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:40:57 Download gff for BO04448.complete
Subject Subject Range Query Range Percent Splice Strand
AnnIX-RB 74..1063 9..998 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:27:33 Download gff for BO04448.complete
Subject Subject Range Query Range Percent Splice Strand
AnxB9-RD 186..1157 17..990 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:27:33 Download gff for BO04448.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21070724..21070774 938..990 96   Plus
3R 21068838..21069019 756..937 100 -> Plus
3R 21068069..21068777 47..755 100 -> Plus
3R 21067470..21067499 17..46 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:56:30 Download gff for BO04448.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16896446..16896496 938..990 96   Plus
arm_3R 16894560..16894741 756..937 100 -> Plus
arm_3R 16893791..16894499 47..755 100 -> Plus
arm_3R 16893192..16893221 17..46 100 -> Plus

BO04448.pep Sequence

Translation from 16 to 1006

> BO04448.pep
MSSAEYYPFKCTPTVYPADPFDPVEDAAILRKAMKGFGTDEKAIIEILAR
RGIVQRLEIAEAFKTSYGKDLISDLKSELGGKFEDVILALMTPLPQFYAQ
ELHDAISGLGTDEEAIIEILCTLSNYGIKTIAQFYEQSFGKSLESDLKGD
TSGHFKRLCVSLVQGNRDENQGVDEAAAIADAQALHDAGEGQWGTDESTF
NSILITRSYQQLRQIFLEYENLSGNDIEKAIKREFSGSVEKGFLAIVKCC
KSKIDYFSERLHDSMAGMGTKDKTLIRIIVSRSEIDLGDIKEAFQNKYGK
SLESWIKDDLSGDYSYVLQCLASYASFLDH

BO04448.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:31:21
Subject Length Description Subject Range Query Range Score Percent Strand
AnxB9-PB 324 CG5730-PB 1..324 1..324 1659 100 Plus
AnxB9-PD 324 CG5730-PD 1..324 1..324 1659 100 Plus
AnxB9-PF 324 CG5730-PF 1..324 1..324 1600 96.6 Plus
AnxB9-PE 324 CG5730-PE 1..324 1..324 1600 96.6 Plus
AnxB9-PC 324 CG5730-PC 1..324 1..324 1600 96.6 Plus