Clone BO04454 Report

Search the DGRC for BO04454

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:44
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptCG12659-RB
Protein status:BO04454.pep: validated full length
Sequenced Size:364

Clone Sequence Records

BO04454.3prime Sequence

362 bp (361 high quality bases) assembled on 2005-12-01

> BO04454.3prime
ATGGTCTAGAAAGCTTGCTCCCACGGCGCTGGTATAGCCGCGCACCATGA
GGTAGCCATTGACGATGTCCGAGGGCATGTGCTGCATGGACGCGTACTCG
TCGGCGCTGGCGAACCTTAGTTTCGTGTGCGGATCGGCATAAGGAGCGGG
CAGACCGCTGATATCCGAGTACTTCTTGGCCGGAACCAACGAGGGCGGTG
CATTGAGCGTGAAGTAGGTGGGTTGTTCGGCGGACAGCTTCTGGCTACGC
TCCATGTTGCTTATCTGACGTAGAGGGCGGTAAACACAGTTCTTTGGAAA
GGTAAACGGACGCTTAAAGGAGCGTTTAGGCTTCGCATTTTGTTCCATGT
CGACTGATAACT

BO04454.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG12659-PB 333 CG12659-RB 1..330 348..19 1650 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 16:04:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12659-RC 896 CG12659-RC 36..365 348..19 1650 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 16:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8591306..8591502 19..215 985 100 Plus
X 23542271 X 8591562..8591694 216..348 665 100 Plus
Blast to na_te.dros performed on 2015-02-12 16:04:57 has no hits.

BO04454.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:03:23 Download gff for BO04454.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12659-PB 1..333 18..348 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:16:42 Download gff for BO04454.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12659-PB 1..333 18..348 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 15:29:14 Download gff for BO04454.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12659-RC 36..371 10..348 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:40:33 Download gff for BO04454.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12659-RC 36..371 10..348 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:40:33 Download gff for BO04454.3prime
Subject Subject Range Query Range Percent Splice Strand
X 8591562..8591694 216..348 100   Plus
X 8591300..8591502 10..215 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 15:29:14 Download gff for BO04454.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 8485595..8485727 216..348 100   Plus
arm_X 8485333..8485535 10..215 98 <- Plus

BO04454.5prime Sequence

362 bp (361 high quality bases) assembled on 2005-11-29

> BO04454.5prime
GAAGTTATCAGTCGACATGGAACAAAATGCGAAGCCTAAACGCTCCTTTA
AGCGTCCGTTTACCTTTCCAAAGAACTGTGTTTACCGCCCTCTACGTCAG
ATAAGCAACATGGAGCGTAGCCAGAAGCTGTCCGCCGAACAACCCACCTA
CTTCACGCTCAATGCACCGCCCTCGTTGGTTCCGGCCAAGAAGTACTCGG
ATATCAGCGGTCTGCCCGCTCCTTATGCCGATCCGCACACGAAACTAAGG
TTCGCCAGCGCCGACGAGTACGCGTCCATGCAGCACATGCCCTCGGACAT
CGTCAATGGCTACCTCATGGTGCGCGGCTATACCAGCGCCGTGGGAGCAA
GCTTTCTAGACC

BO04454.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG12659-PB 333 CG12659-RB 1..330 17..346 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 05:34:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG12659-RC 896 CG12659-RC 36..365 17..346 1650 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 05:34:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8591306..8591502 346..150 985 100 Minus
X 23542271 X 8591562..8591694 149..17 665 100 Minus
Blast to na_te.dros performed on 2015-02-13 05:34:38 has no hits.

BO04454.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:03:24 Download gff for BO04454.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12659-PB 1..333 17..347 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:16:43 Download gff for BO04454.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12659-PB 1..333 17..347 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 17:54:01 Download gff for BO04454.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12659-RC 36..371 17..355 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 07:48:02 Download gff for BO04454.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12659-RC 36..371 17..355 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 07:48:02 Download gff for BO04454.5prime
Subject Subject Range Query Range Percent Splice Strand
X 8591562..8591694 17..149 100   Minus
X 8591300..8591502 150..355 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 17:54:01 Download gff for BO04454.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 8485595..8485727 17..149 100   Minus
arm_X 8485333..8485535 150..355 98 <- Minus

BO04454.complete Sequence

364 bp (364 high quality bases) assembled on 2005-10-17

GenBank Submission: FJ629772

> BO04454.complete
GAAGTTATCAGTCGACATGGAACAAAATGCGAAGCCTAAACGCTCCTTTA
AGCGTCCGTTTACCTTTCCAAAGAACTGTGTTTACCGCCCTCTACGTCAG
ATAAGCAACATGGAGCGTAGCCAGAAGCTGTCCGCCGAACAACCCACCTA
CTTCACGCTCAATGCACCGCCCTCGTTGGTTCCGGCCAAGAAGTACTCGG
ATATCAGCGGTCTGCCCGCTCCTTATGCCGATCCGCACACGAAACTAAGG
TTCGCCAGCGCCGACGAGTACGCGTCCATGCAGCACATGCCCTCGGACAT
CGTCAATGGCTACCTCATGGTGCGCGGCTATACCAGCGCCGTGGGAGCAA
GCTTTCTAGACCAT

BO04454.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG12659-RC 333 CG12659-PC 1..330 17..346 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG12659-RC 896 CG12659-RC 36..365 17..346 1650 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8591306..8591502 346..150 985 100 Minus
X 23542271 X 8591562..8591694 149..17 665 100 Minus
Blast to na_te.dros performed on 2014-11-28 00:34:09 has no hits.

BO04454.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:40:40 Download gff for BO04454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RB 1..333 17..347 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:02:52 Download gff for BO04454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RB 298..633 17..355 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:54:49 Download gff for BO04454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RC 36..365 17..348 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:40:41 Download gff for BO04454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RB 298..633 17..355 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:22:47 Download gff for BO04454.complete
Subject Subject Range Query Range Percent Splice Strand
CG12659-RC 36..365 17..348 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:22:47 Download gff for BO04454.complete
Subject Subject Range Query Range Percent Splice Strand
X 8591562..8591694 17..149 100   Minus
X 8591304..8591502 150..348 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:54:49 Download gff for BO04454.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8485595..8485727 17..149 100   Minus
arm_X 8485337..8485535 150..348 98 <- Minus

BO04454.pep Sequence

Translation from 16 to 364

> BO04454.pep
MEQNAKPKRSFKRPFTFPKNCVYRPLRQISNMERSQKLSAEQPTYFTLNA
PPSLVPAKKYSDISGLPAPYADPHTKLRFASADEYASMQHMPSDIVNGYL
MVRGYTSAVGASFLDH

BO04454.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:52:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG12659-PC 110 CG12659-PC 1..110 1..110 580 100 Plus