Clone BO04682 Report

Search the DGRC for BO04682

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:46
Well:82
Vector:pDNR-Dual
Associated Gene/TranscriptRab11-RA
Protein status:BO04682.pep: validated full length
Sequenced Size:676

Clone Sequence Records

BO04682.3prime Sequence

674 bp (673 high quality bases) assembled on 2005-12-01

> BO04682.3prime
ATGGTCTAGAAAGCTTGCCTGACAGCACTGTTTGCGCACATCGGCGGTGA
CAGTCGGCTTTACGTCGATGGGCTCCACGTTCGACGGGCGGATGACGTCG
CCTTCCGGCGGATCTCTGATTTGTTTCTGCGACACAATGCGATAGATCTC
TGTGAGTATGTTCTGGAATGCCGTTTCAACGTTCGTCGAGTCTAGGGCCG
AGGTTTCTATGAAACTCAAGCCGTTGCGCTCGGCAAACAGCTTCGCCTCG
TCCGTGGGCACGGAGCGCAAGTGCCGCAAGTCGGACTTGTTGCCCACCAG
CATGATGACGATGTTCTGGTCGGCATGGTCGCGCAATTCCCGCAGCCACC
GCTCCACGTTCTCGTAGGTCAGATGCTTGGCAATGTCATAGACGAGCAGG
GCCCCCACGGCACCGCGGTAGTAGGCAGAGGTGATGGCGCGATAACGCTC
CTGGCCGGCCGTATCCCAGATTTGCGCTTTAATTGTTTTGCCATCGACCT
CTATGCTGCGCGTTGCAAACTCAACGCCAATCGTCGACTTGGACTCCAAA
TTGAATTCATTGCGCGTGAAACGTGAGAGCAAATTACTTTTGCCAACACC
GGAGTCACCGATAAGGACAACTTTGAACAGATAATCGTACTCGTCTTCTC
TTGCACCCATGTCGACTGATAACT

BO04682.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG5771-PB 645 Rab11-RB 1..642 660..19 3110 99.3 Minus
CG5771-PA 645 Rab11-RA 1..642 660..19 3110 99.3 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 13:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
Rab11-RA 1815 CG5771-RA 409..1050 660..19 3150 99.4 Minus
Rab11-RB 1627 CG5771-RB 221..862 660..19 3150 99.4 Minus
Rab8-RC 2043 CG8287-RC 751..843 475..383 180 79.6 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 13:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21114751..21115101 500..150 1725 99.4 Minus
3R 32079331 3R 21115248..21115381 152..19 655 99.3 Minus
3R 32079331 3R 21113944..21114069 622..497 615 99.2 Minus
3R 32079331 3R 21111816..21111855 660..621 200 100 Minus
Blast to na_te.dros performed on 2015-02-13 13:29:58 has no hits.

BO04682.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:08:16 Download gff for BO04682.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab11-PB 1..645 16..660 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:23:44 Download gff for BO04682.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5771-PA 1..645 16..660 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 17:42:42 Download gff for BO04682.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab11-RB 215..862 19..667 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 15:41:19 Download gff for BO04682.3prime
Subject Subject Range Query Range Percent Splice Strand
Rab11-RB 215..862 19..667 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 15:41:19 Download gff for BO04682.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 21115251..21115381 19..149 99   Minus
3R 21114753..21115101 150..498 99 -> Minus
3R 21113946..21114067 499..620 99 -> Minus
3R 21111810..21111855 621..667 93 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 17:42:42 Download gff for BO04682.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16940973..16941103 19..149 99   Minus
arm_3R 16940475..16940823 150..498 99 -> Minus
arm_3R 16939668..16939789 499..620 99 -> Minus
arm_3R 16937532..16937577 621..667 93 -> Minus

BO04682.5prime Sequence

674 bp (673 high quality bases) assembled on 2005-12-01

> BO04682.5prime
GAAGTTATCAGTCGACATGGGTGCAAGAGAAGACGAGTACGATTATCTGT
TCAAAGTTGTCCTTATCGGTGACTCCGGTGTTGGCAAAAGTAATTTGCTC
TCACGTTTCACGCGCAATGAATTCAATTTGGAGTCCAAGTCGACGATTGG
CGTTGAGTTTGCAACGCGCAGCATAGAGGTCGATGGCAAAACAATTAAAG
CGCAAATCTGGGATACGGCCGGCCAGGAGCGTTATCGCGCCATCACCTCT
GCCTACTACCGCGGTGCCGTGGGGGCCCTGCTCGTCTATGACATTGCCAA
GCATCTGACCTACGAGAACGTGGAGCGGTGGCTGCGGGAATTGCGCGACC
ATGCCGACCAGAACATCGTCATCATGCTGGTGGGCAACAAGTCCGACTTG
CGGCACTTGCGCTCCGTGCCCACGGACGAGGCGAAGCTGTTTGCCGAGCG
CAACGGCTTGAGTTTCATAGAAACCTCGGCCCTAGACTCGACGAACGTTG
AAACGGCATTCCAGAACATACTCACAGAGATCTATCGCATTGTGTCGCAG
AAACAAATCAGAGATCCGCCGGAAGGCGACGTCATCCGCCCGTCGAACGT
GGAGCCCATCGACGTAAAGCCGACTGTCACCGCCGATGTGCGCAAACAGT
GCTGTCAGGCAAGCTTTCTAGACC

BO04682.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG5771-PB 645 Rab11-RB 1..642 17..658 3110 99.3 Plus
CG5771-PA 645 Rab11-RA 1..642 17..658 3110 99.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 19:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
Rab11-RA 1815 CG5771-RA 409..1050 17..658 3150 99.4 Plus
Rab11-RB 1627 CG5771-RB 221..862 17..658 3150 99.4 Plus
Rab8-RC 2043 CG8287-RC 751..843 202..294 180 79.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 19:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21114751..21115101 177..527 1725 99.4 Plus
3R 32079331 3R 21115248..21115381 525..658 655 99.3 Plus
3R 32079331 3R 21113944..21114069 55..180 615 99.2 Plus
3R 32079331 3R 21111816..21111855 17..56 200 100 Plus
Blast to na_te.dros performed on 2015-02-04 19:27:42 has no hits.

BO04682.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:08:17 Download gff for BO04682.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab11-PB 1..645 17..661 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:23:46 Download gff for BO04682.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5771-PA 1..645 17..661 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:17:25 Download gff for BO04682.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab11-RB 215..862 10..658 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:33:49 Download gff for BO04682.5prime
Subject Subject Range Query Range Percent Splice Strand
Rab11-RB 215..862 10..658 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:33:49 Download gff for BO04682.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 21115251..21115381 528..658 99   Plus
3R 21114753..21115101 179..527 99 -> Plus
3R 21113946..21114067 57..178 99 -> Plus
3R 21111810..21111855 10..56 93 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:17:25 Download gff for BO04682.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16940973..16941103 528..658 99   Plus
arm_3R 16940475..16940823 179..527 99 -> Plus
arm_3R 16939668..16939789 57..178 99 -> Plus
arm_3R 16937532..16937577 10..56 93 -> Plus

BO04682.complete Sequence

676 bp (676 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629841

> BO04682.complete
GAAGTTATCAGTCGACATGGGTGCAAGAGAAGACGAGTACGATTATCTGT
TCAAAGTTGTCCTTATCGGTGACTCCGGTGTTGGCAAAAGTAATTTGCTC
TCACGTTTCACGCGCAATGAATTCAATTTGGAGTCCAAGTCGACGATTGG
CGTTGAGTTTGCAACGCGCAGCATAGAGGTCGATGGCAAAACAATTAAAG
CGCAAATCTGGGATACGGCCGGCCAGGAGCGTTATCGCGCCATCACCTCT
GCCTACTACCGCGGTGCCGTGGGGGCCCTGCTCGTCTATGACATTGCCAA
GCATCTGACCTACGAGAACGTGGAGCGGTGGCTGCGGGAATTGCGCGACC
ATGCCGACCAGAACATCGTCATCATGCTGGTGGGCAACAAGTCCGACTTG
CGGCACTTGCGCTCCGTGCCCACGGACGAGGCGAAGCTGTTTGCCGAGCG
CAACGGCTTGAGTTTCATAGAAACCTCGGCCCTAGACTCGACGAACGTTG
AAACGGCATTCCAGAACATACTCACAGAGATCTATCGCATTGTGTCGCAG
AAACAAATCAGAGATCCGCCGGAAGGCGACGTCATCCGCCCGTCGAACGT
GGAGCCCATCGACGTAAAGCCGACTGTCACCGCCGATGTGCGCAAACAGT
GCTGTCAGGCAAGCTTTCTAGACCAT

BO04682.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:17
Subject Length Description Subject Range Query Range Score Percent Strand
Rab11-RA 645 CG5771-PA 1..642 17..658 3150 99.4 Plus
Rab11-RB 645 CG5771-PB 1..642 17..658 3150 99.4 Plus
Rab8-RC 624 CG8287-PC 177..269 202..294 180 79.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
Rab11-RA 1815 CG5771-RA 409..1050 17..658 3150 99.4 Plus
Rab11-RB 1627 CG5771-RB 221..862 17..658 3150 99.4 Plus
Rab8-RC 2043 CG8287-RC 751..843 202..294 180 79.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:34:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21114751..21115101 177..527 1725 99.4 Plus
3R 32079331 3R 21115248..21115381 525..658 655 99.3 Plus
3R 32079331 3R 21113944..21114069 55..180 615 99.2 Plus
3R 32079331 3R 21111816..21111855 17..56 200 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:34:16 has no hits.

BO04682.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:53:42 Download gff for BO04682.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RA 1..645 17..661 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:25:55 Download gff for BO04682.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RA 404..1051 10..658 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:30:28 Download gff for BO04682.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RB 221..862 17..660 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:53:42 Download gff for BO04682.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RA 404..1051 10..658 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:42 Download gff for BO04682.complete
Subject Subject Range Query Range Percent Splice Strand
Rab11-RB 221..862 17..660 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:42 Download gff for BO04682.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21115251..21115381 528..660 97   Plus
3R 21114753..21115101 179..527 99 -> Plus
3R 21113946..21114067 57..178 99 -> Plus
3R 21111816..21111855 17..56 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:30:28 Download gff for BO04682.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16940973..16941103 528..660 97   Plus
arm_3R 16940475..16940823 179..527 99 -> Plus
arm_3R 16939668..16939789 57..178 99 -> Plus
arm_3R 16937538..16937577 17..56 100 -> Plus

BO04682.pep Sequence

Translation from 16 to 676

> BO04682.pep
MGAREDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFAT
RSIEVDGKTIKAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLTYE
NVERWLRELRDHADQNIVIMLVGNKSDLRHLRSVPTDEAKLFAERNGLSF
IETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDVIRPSNVEPIDV
KPTVTADVRKQCCQASFLDH

BO04682.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
Rab11-PA 214 CG5771-PA 1..214 1..214 1091 100 Plus
Rab11-PB 214 CG5771-PB 1..214 1..214 1091 100 Plus
Rab14-PD 215 CG4212-PD 1..181 1..181 478 51.9 Plus
Rab14-PA 215 CG4212-PA 1..181 1..181 478 51.9 Plus
Rab14-PB 239 CG4212-PB 25..205 1..181 478 51.9 Plus