Clone BO04685 Report

Search the DGRC for BO04685

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:46
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCG8635-RA
Protein status:BO04685.pep: validated full length
Sequenced Size:1246

Clone Sequence Records

BO04685.3prime Sequence

903 bp (846 high quality bases) assembled on 2005-12-01

> BO04685.3prime
ATGGTCTAGAAAGCTTGCGTCATCGTCCTCATCGTCCAGATCTAGGTCAT
CCAGTTCGCCGGCCAGATCAACAAAGAGATCCTTGTTGATGGGGGCAGCA
TCGTTGGCGGGTGCAGACGACGATGGGCCATCCTCGTCGGCCGCTGCGTC
CTCGGCTGCGGCGGTTTTGGCTGCTTCGGTTGCCTGGTCCAGTAGTCGAT
TGGTGGAGGCAATGGTGCCCGAGCCGTCCACCTCCTTGGCGGCCAGCGAC
AGGGCAGCCAGATCCAGTTCCTTGAACTCGACGGCATTATCGTCGTCGTC
CTCCCTGTTGTAGACGTCGAAAGCAGCGTCGCCCTCCTCCATGGGTCCGT
CGTCGACCAGATCCGGATTGAAGCTGAACATTTCGCGACCAGAGATGCCG
AACTGTTTGCCCTTGCTGAAGTCACTCTTCTTGCGCTCTTCCTCGGCAGC
CAGCTTGGCCTTCTTCTCGGCAATCTTGCGCTTCTTCCAGGCGAGGAAGG
ACTCGAGGGTGACGCGTGTCTGGTTGGGACCGAGGGCAGCGCGCTCCTTC
TCAATTAAATCGACCAGCGAGATTTCCGTGGGCTTTTCCTCCTTCTTCTT
ATCGCGCTTCAGCACATATCCAGCTGGCAAGGCGTGACGGTAGATGCACT
TTCCGCCGTTGGGGCACTCCCAGAACCAGCCGTACTTTGATTTTTCCACA
GCTTCCAGGAAGAATTTGCAAATAATATCCGTGGTGGGACGTTGCTTTTC
GCCGGAGCTCTTCTTCTCGACCACCTCCTTCAGCTTGGCATCGTCCCAGT
TGGTCATCGGATCGTCCTCGTCGCGCATGTCCACATAAATGGACCGCTTT
TCGACCTTGTTCTCCTGGGAAAGATCGTGGGAGAACTTGCACTTGTCGCC
CTT

BO04685.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG8635-PA 1215 CG8635-RA 328..1212 903..19 4425 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:11:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG8635-RB 1447 CG8635-RB 461..1345 903..19 4425 100 Minus
CG8635-RA 1572 CG8635-RA 586..1470 903..19 4425 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 01:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8630309..8631013 19..723 3525 100 Plus
2R 25286936 2R 8631072..8631251 724..903 900 100 Plus
Blast to na_te.dros performed on 2015-02-12 01:11:01 has no hits.

BO04685.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:08:20 Download gff for BO04685.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8635-PA 328..1215 18..903 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:23:50 Download gff for BO04685.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8635-PA 328..1215 18..903 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:39:04 Download gff for BO04685.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 586..1470 19..903 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:11:41 Download gff for BO04685.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 586..1470 19..903 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 05:11:41 Download gff for BO04685.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 8631072..8631251 724..903 100   Plus
2R 8630309..8631013 19..723 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:39:04 Download gff for BO04685.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4518577..4518756 724..903 100   Plus
arm_2R 4517814..4518518 19..723 100 <- Plus

BO04685.5prime Sequence

912 bp (783 high quality bases) assembled on 2005-12-01

> BO04685.5prime
GAAGTTATCAGTCGACATGCCACCCAAAAAGGCGCCACCAGGTCCCAGCA
AGAAGACGGAGCAGAAAAAGAAGGAGAAAGTCATTGAGGACAAAACCTTC
GGGCTGAAGAACAAGAAGGGCAACAAGCAGCAGAAGTTCATCCAGCAGGT
GCAGAAGCAGGTCCAGTCCGGCGGACAGCATCCTCGCCAGGATGGCGACA
AGCGCAAGGAGGAGAAGGAGAAGAAGCTGGCCGAACAGCGCGAGATGGCG
CTGATCTTCAAGCCGGTACAGACTCAGAAGGTGGAGAAGGGCACCGATCC
CAAGTCGGTGGTCTGCGCCTTCTTCAAACAGGGCACCTGCACCAAGGGCG
ACAAGTGCAAGTTCTCCCACGATCTTTCCCAGGAGAACAAGGTCGAAAAG
CGGTCCATTTATGTGGACATGCGCGACGAGGACGATCCGATGACCAACTG
GGACGATGCCAAGCTGAAGGAGGTGGTCGAGAAGAAGAGCTCCGGCGAAA
AGCAACGTCCCACCACGGATATTATTTGCAAATTCTTCCTGGAAGCTGTG
GAAAAATCAAAGTACGGCTGGTTCTGGGAGTGCCCCAACGGCGGAAAGTG
CATCTACCGTCACGCCTTGCCAGCTGGATATGTGCTGAAGCGCGATAAGA
AGAAGGAGGAAAAGCCCACGGAAATCTCGCTGGTCGATTTAATTGAGAAG
GAGCGCGCTGCCCTCGGTCCCAACCAGACACGCGTCACCCTCGAGTCCTT
CCTCGCCTGGAAGAAGCGCAAGATTGCCGAGAAGAANGCCAAGCTGGCTG
CCGAGGAAGAGCGCAAGAAGAGTGACTTCAGCAAGGGCAAACAGTTCGGC
ATCTCTGGTCGCGAAATGTTCAGCTTCAATCGGGATCTGGTCGACGACGG
ACCCATGGAGGA

BO04685.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG8635-PA 1215 CG8635-RA 1..896 17..912 4436 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 05:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG8635-RB 1447 CG8635-RB 134..1029 17..912 4454 99.8 Plus
CG8635-RA 1572 CG8635-RA 259..1154 17..912 4454 99.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 05:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8631072..8631508 523..87 2185 100 Minus
2R 25286936 2R 8630625..8631013 912..524 1919 99.5 Minus
2R 25286936 2R 8631632..8631704 89..17 365 100 Minus
Blast to na_te.dros performed on 2015-02-13 05:38:38 has no hits.

BO04685.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:08:21 Download gff for BO04685.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8635-PA 1..895 17..911 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:23:52 Download gff for BO04685.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8635-PA 1..895 17..911 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 17:54:54 Download gff for BO04685.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 259..1153 17..911 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 07:54:17 Download gff for BO04685.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 259..1153 17..911 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 07:54:17 Download gff for BO04685.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 8631633..8631704 17..88 100   Minus
2R 8631072..8631506 89..523 100 <- Minus
2R 8630626..8631013 524..911 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 17:54:54 Download gff for BO04685.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4519138..4519209 17..88 100   Minus
arm_2R 4518577..4519011 89..523 100 <- Minus
arm_2R 4518131..4518518 524..911 99 <- Minus

BO04685.complete Sequence

1246 bp (1246 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629843

> BO04685.complete
GAAGTTATCAGTCGACATGCCACCCAAAAAGGCGCCACCAGGTCCCAGCA
AGAAGACGGAGCAGAAAAAGAAGGAGAAAGTCATTGAGGACAAAACCTTC
GGGCTGAAGAACAAGAAGGGCAACAAGCAGCAGAAGTTCATCCAGCAGGT
GCAGAAGCAGGTCCAGTCCGGCGGACAGCATCCTCGCCAGGATGGCGACA
AGCGCAAGGAGGAGAAGGAGAAGAAGCTGGCCGAACAGCGCGAGATGGCG
CTGATCTTCAAGCCGGTACAGACTCAGAAGGTGGAGAAGGGCACCGATCC
CAAGTCGGTGGTCTGCGCCTTCTTCAAACAGGGCACCTGCACCAAGGGCG
ACAAGTGCAAGTTCTCCCACGATCTTTCCCAGGAGAACAAGGTCGAAAAG
CGGTCCATTTATGTGGACATGCGCGACGAGGACGATCCGATGACCAACTG
GGACGATGCCAAGCTGAAGGAGGTGGTCGAGAAGAAGAGCTCCGGCGAAA
AGCAACGTCCCACCACGGATATTATTTGCAAATTCTTCCTGGAAGCTGTG
GAAAAATCAAAGTACGGCTGGTTCTGGGAGTGCCCCAACGGCGGAAAGTG
CATCTACCGTCACGCCTTGCCAGCTGGATATGTGCTGAAGCGCGATAAGA
AGAAGGAGGAAAAGCCCACGGAAATCTCGCTGGTCGATTTAATTGAGAAG
GAGCGCGCTGCCCTCGGTCCCAACCAGACACGCGTCACCCTCGAGTCCTT
CCTCGCCTGGAAGAAGCGCAAGATTGCCGAGAAGAAGGCCAAGCTGGCTG
CCGAGGAAGAGCGCAAGAAGAGTGACTTCAGCAAGGGCAAACAGTTCGGC
ATCTCTGGTCGCGAAATGTTCAGCTTCAATCCGGATCTGGTCGACGACGG
ACCCATGGAGGAGGGCGACGCTGCTTTCGACGTCTACAACAGGGAGGACG
ACGACGATAATGCCGTCGAGTTCAAGGAACTGGATCTGGCTGCCCTGTCG
CTGGCCGCCAAGGAGGTGGACGGCTCGGGCACCATTGCCTCCACCAATCG
ACTACTGGACCAGGCAACCGAAGCAGCCAAAACCGCCGCAGCCGAGGACG
CAGCGGCCGACGAGGATGGCCCATCGTCGTCTGCACCCGCCAACGATGCT
GCCCCCATCAACAAGGATCTCTTTGTTGATCTGGCCGGCGAACTGGATGA
CCTAGATCTGGACGATGAGGACGATGACGCAAGCTTTCTAGACCAT

BO04685.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:35:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG8635-RB 1215 CG8635-PB 1..1212 17..1228 6060 100 Plus
CG8635-RA 1215 CG8635-PA 1..1212 17..1228 6060 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG8635-RB 1447 CG8635-RB 134..1345 17..1228 6060 100 Plus
CG8635-RA 1572 CG8635-RA 259..1470 17..1228 6060 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8630309..8631013 1228..524 3525 100 Minus
2R 25286936 2R 8631072..8631508 523..87 2185 100 Minus
2R 25286936 2R 8631632..8631704 89..17 365 100 Minus
Blast to na_te.dros performed on 2014-11-28 00:35:35 has no hits.

BO04685.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:39:43 Download gff for BO04685.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 1..1215 17..1229 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:08:37 Download gff for BO04685.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 259..1470 17..1228 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:55:19 Download gff for BO04685.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 259..1470 17..1230 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:39:43 Download gff for BO04685.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 259..1470 17..1228 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:23:09 Download gff for BO04685.complete
Subject Subject Range Query Range Percent Splice Strand
CG8635-RA 259..1470 17..1230 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:23:09 Download gff for BO04685.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8631633..8631704 17..88 100   Minus
2R 8631072..8631506 89..523 100 <- Minus
2R 8630307..8631013 524..1230 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:55:19 Download gff for BO04685.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4519138..4519209 17..88 100   Minus
arm_2R 4518577..4519011 89..523 100 <- Minus
arm_2R 4517812..4518518 524..1230 99 <- Minus

BO04685.pep Sequence

Translation from 16 to 1246

> BO04685.pep
MPPKKAPPGPSKKTEQKKKEKVIEDKTFGLKNKKGNKQQKFIQQVQKQVQ
SGGQHPRQDGDKRKEEKEKKLAEQREMALIFKPVQTQKVEKGTDPKSVVC
AFFKQGTCTKGDKCKFSHDLSQENKVEKRSIYVDMRDEDDPMTNWDDAKL
KEVVEKKSSGEKQRPTTDIICKFFLEAVEKSKYGWFWECPNGGKCIYRHA
LPAGYVLKRDKKKEEKPTEISLVDLIEKERAALGPNQTRVTLESFLAWKK
RKIAEKKAKLAAEEERKKSDFSKGKQFGISGREMFSFNPDLVDDGPMEEG
DAAFDVYNREDDDDNAVEFKELDLAALSLAAKEVDGSGTIASTNRLLDQA
TEAAKTAAAEDAAADEDGPSSSAPANDAAPINKDLFVDLAGELDDLDLDD
EDDDASFLDH

BO04685.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG8635-PB 404 CG8635-PB 1..404 1..404 2103 100 Plus
CG8635-PA 404 CG8635-PA 1..404 1..404 2103 100 Plus