Clone BO04802 Report

Search the DGRC for BO04802

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:48
Well:2
Vector:pDNR-Dual
Associated Gene/Transcriptbsk-RB
Protein status:BO04802.pep: validated full length
Sequenced Size:1150

Clone Sequence Records

BO04802.3prime Sequence

942 bp (793 high quality bases) assembled on 2005-12-02

> BO04802.3prime
ATGGTCTAGAAAGCTTGCCCGCGTTCTATTATTTGTATTGTGTGCTTCGT
AGTCCATGACTTCCTCATAGATTAGCTCCTTCCACTGCTCCACAGTGTGT
TCCCTTTCGTCCACGCTGTGATCATATGGCTCCGGAGCGGGAGCATCCAC
TTCCTCAGCATCATACCACACGTTGATATATTCATGCTTCAAAGCCTCGT
CCACAGATATCCGCTGCTCTGGATCAATGACTAGCATTTTACTAAGAAGA
TTTCTAGCGTCAGAAGCCTTCCGGCGGCTATTCTGATTATTATCATTTGG
AAACAAGCCATCGGGGAAAAGTCTATCAAATGAGTATCCAGTGTATCTAG
GACGATTTTCCACATAGTTTCGGACGGTTGGCTGTAACCGTTGCATAAAC
GAGGGTGATGGTGTACCTAATTGCTCAATAATTTTATTCCACTGATCTAT
ATGATCCGTTCCAGGAAACAGCACACCGCCCCGTATCATTTCGCCCATAA
TGCAACCGACGGACCATATGTCCACGTTCTCTGTGTATCCCATGCCCAAA
ATGACCTCTGGAGCCCTGTAATATCGGGTGACCACATAGGGAGTCATCAT
AAAGGTAGTTCCTGCAGTACGTGCCAGACCGAAATCCAAAATTTTTAGAG
TGCAGTCGGCCTTTACAACTATATTGGATGGCTTTAAGTCTCTGTGAATA
ATTCCTGCTGAGTGTAAATGTTTTATTCCGCACAACATTTGATAAAGCAA
ATAGGACATTCTGTCGTGATCCAAGTCCATTTGGATGACCTGGCAGAGAT
TAGCGTCCATCAGCTCCATGACCAGGTAGACATCCTGAAACTCTTCCAAG
TTCCTTTGCGGCGTAAAAGCATTAAGTAAGCCAATTATGTTTTTATGGGT
AACAAGCTTCATTAGCTTTGAATTCCCTATATGCTCGCTTGG

BO04802.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG5680-PB 1119 bsk-RB 217..1116 918..19 4475 99.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
bsk-RE 1655 CG5680-RE 584..1506 942..19 4580 99.8 Minus
bsk-RF 1797 CG5680-RF 726..1648 942..19 4580 99.8 Minus
bsk-RB 1535 CG5680-RB 464..1386 942..19 4580 99.8 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 02:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10247852..10248136 142..426 1425 100 Plus
2L 23513712 2L 10248197..10248461 426..690 1325 100 Plus
2L 23513712 2L 10248524..10248722 690..888 995 100 Plus
2L 23513712 2L 10247651..10247773 19..141 615 100 Plus
2L 23513712 2L 10248785..10248837 889..942 205 96.3 Plus
Blast to na_te.dros performed on 2015-02-13 02:12:16 has no hits.

BO04802.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:10:19 Download gff for BO04802.3prime
Subject Subject Range Query Range Percent Splice Strand
bsk-PB 194..1119 18..942 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:26:51 Download gff for BO04802.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5680-PB 194..1119 18..942 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 06:35:12 Download gff for BO04802.3prime
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 464..1386 19..942 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:36:54 Download gff for BO04802.3prime
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 464..1386 19..942 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:36:54 Download gff for BO04802.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 10248785..10248837 889..942 96   Plus
2L 10248525..10248722 691..888 100 <- Plus
2L 10248197..10248461 426..690 100 <- Plus
2L 10247852..10248135 142..425 100 <- Plus
2L 10247651..10247773 19..141 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 06:35:12 Download gff for BO04802.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10248785..10248837 889..942 96   Plus
arm_2L 10248525..10248722 691..888 100 <- Plus
arm_2L 10248197..10248461 426..690 100 <- Plus
arm_2L 10247852..10248135 142..425 100 <- Plus
arm_2L 10247651..10247773 19..141 100 <- Plus

BO04802.5prime Sequence

894 bp (777 high quality bases) assembled on 2005-11-29

> BO04802.5prime
GAAGTTATCAGTCGACATGACGACAGCTCAGCACCAACACTACACCGTCG
AGGTGGGGGACACCAACTTCACCATCCACAGTCGGTACATTAATCTACGG
CCCATAGGATCAGGTGCCCAAGGAATAGTATGCGCCGCTTACGATACTAT
CACCCAGCAAAATGTGGCGATTAAGAAACTATCTCGACCATTCCAAAATG
TAACCCATGCCAAGCGAGCATATAGGGAATTCAAGCTAATGAAGCTTGTT
AACCATAAAAACATAATTGGCTTACTTAATGCTTTTACGCCGCAAAGGAA
CTTGGAAGAGTTTCAGGATGTCTACCTGGTCATGGAGCTGATGGACGCTA
ATCTCTGCCAGGTCATCCAAATGGACTTGGATCACGACAGAATGTCCTAT
TTGCTTTATCAAATGTTGTGCGGAATAAAACATTTACACTCAGCAGGAAT
TATTCACAGAGACTTAAAGCCATCCAATATAGTTGTAAAGGCCGACTGCA
CTCTAAAAATTTTGGATTTCGGTCTGGCACGTACTGCAGGAACTACCTTT
ATGATGACTCCCTATGTGGTCACCCGATATTACAGGGCTCCAGAGGTCAT
TTTGGGCATGGGATACACAGAGAACGTGGACATATGGTCCGTCGGTTGCA
TTATGGGCGAAATGATACGGGGCGGTGTGCTGTTTCCTGGAACGGATCAT
ATAGATCAGTGGAATAAAATTATTGAGCAATTAGGTACACCATCACCCTC
GTTTATGCAACGGTTACAGCCAACCGTCCGAAACTATGTGGAAAATCGTC
CTAGATACACTGGATACTCATTTGATAGACTTTTCCCCGATGGCTTGTTT
CAAATGATAATAATCAGAATAGCCGCCGGAAGGCTTCTGACGCT

BO04802.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG5680-PB 1119 bsk-RB 1..835 17..851 4175 100 Plus
CG5680-PB 1119 bsk-RB 836..879 851..894 220 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 19:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
bsk-RE 1655 CG5680-RE 391..1269 17..894 4370 99.9 Plus
bsk-RF 1797 CG5680-RF 533..1411 17..894 4370 99.9 Plus
bsk-RB 1535 CG5680-RB 271..1149 17..894 4370 99.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 19:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10248197..10248461 725..461 1325 100 Minus
2L 23513712 2L 10248524..10248722 461..263 995 100 Minus
2L 23513712 2L 10247966..10248136 894..725 805 99.4 Minus
2L 23513712 2L 10248785..10248915 262..132 655 100 Minus
2L 23513712 2L 10249095..10249210 132..17 580 100 Minus
Blast to na_te.dros performed on 2015-02-04 19:28:52 has no hits.

BO04802.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:10:20 Download gff for BO04802.5prime
Subject Subject Range Query Range Percent Splice Strand
bsk-PB 1..879 17..894 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:26:53 Download gff for BO04802.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5680-PB 1..879 17..894 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 21:17:39 Download gff for BO04802.5prime
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 260..1149 7..894 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 21:34:28 Download gff for BO04802.5prime
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 260..1149 7..894 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 21:34:28 Download gff for BO04802.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 10249095..10249221 7..132 97   Minus
2L 10248785..10248914 133..262 100 <- Minus
2L 10248525..10248722 263..460 100 <- Minus
2L 10248197..10248461 461..725 100 <- Minus
2L 10247966..10248135 726..894 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 21:17:39 Download gff for BO04802.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10249095..10249221 7..132 97   Minus
arm_2L 10248785..10248914 133..262 100 <- Minus
arm_2L 10248525..10248722 263..460 100 <- Minus
arm_2L 10248197..10248461 461..725 100 <- Minus
arm_2L 10247966..10248135 726..894 99 <- Minus

BO04802.complete Sequence

1150 bp (1150 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629865

> BO04802.complete
GAAGTTATCAGTCGACATGACGACAGCTCAGCACCAACACTACACCGTCG
AGGTGGGGGACACCAACTTCACCATCCACAGTCGGTACATTAATCTACGG
CCCATAGGATCAGGTGCCCAAGGAATAGTATGCGCCGCTTACGATACTAT
CACCCAGCAAAATGTGGCGATTAAGAAACTATCTCGACCATTCCAAAATG
TAACCCATGCCAAGCGAGCATATAGGGAATTCAAGCTAATGAAGCTTGTT
AACCATAAAAACATAATTGGCTTACTTAATGCTTTTACGCCGCAAAGGAA
CTTGGAAGAGTTTCAGGATGTCTACCTGGTCATGGAGCTGATGGACGCTA
ATCTCTGCCAGGTCATCCAAATGGACTTGGATCACGACAGAATGTCCTAT
TTGCTTTATCAAATGTTGTGCGGAATAAAACATTTACACTCAGCAGGAAT
TATTCACAGAGACTTAAAGCCATCCAATATAGTTGTAAAGGCCGACTGCA
CTCTAAAAATTTTGGATTTCGGTCTGGCACGTACTGCAGGAACTACCTTT
ATGATGACTCCCTATGTGGTCACCCGATATTACAGGGCTCCAGAGGTCAT
TTTGGGCATGGGATACACAGAGAACGTGGACATATGGTCCGTCGGTTGCA
TTATGGGCGAAATGATACGGGGCGGTGTGCTGTTTCCTGGAACGGATCAT
ATAGATCAGTGGAATAAAATTATTGAGCAATTAGGTACACCATCACCCTC
GTTTATGCAACGGTTACAGCCAACCGTCCGAAACTATGTGGAAAATCGTC
CTAGATACACTGGATACTCATTTGATAGACTTTTCCCCGATGGCTTGTTT
CCAAATGATAATAATCAGAATAGCCGCCGGAAGGCTTCTGACGCTAGAAA
TCTTCTTAGTAAAATGCTAGTCATTGATCCAGAGCAGCGGATATCTGTGG
ACGAGGCTTTGAAGCATGAATATATCAACGTGTGGTATGATGCTGAGGAA
GTGGATGCTCCCGCTCCGGAGCCATATGATCACAGCGTGGACGAAAGGGA
ACACACTGTGGAGCAGTGGAAGGAGCTAATCTATGAGGAAGTCATGGACT
ACGAAGCACACAATACAAATAATAGAACGCGGGCAAGCTTTCTAGACCAT

BO04802.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
bsk-RE 1119 CG5680-PE 1..1116 17..1132 5580 100 Plus
bsk-RF 1119 CG5680-PF 1..1116 17..1132 5580 100 Plus
bsk-RB 1119 CG5680-PB 1..1116 17..1132 5580 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
bsk-RE 1655 CG5680-RE 391..1506 17..1132 5580 100 Plus
bsk-RF 1797 CG5680-RF 533..1648 17..1132 5580 100 Plus
bsk-RB 1535 CG5680-RB 271..1386 17..1132 5580 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:44:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10247852..10248136 1009..725 1425 100 Minus
2L 23513712 2L 10248197..10248461 725..461 1325 100 Minus
2L 23513712 2L 10248524..10248722 461..263 995 100 Minus
2L 23513712 2L 10248785..10248915 262..132 655 100 Minus
2L 23513712 2L 10247651..10247773 1132..1010 615 100 Minus
2L 23513712 2L 10249095..10249210 132..17 580 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:44:10 has no hits.

BO04802.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:39:20 Download gff for BO04802.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 1..1119 17..1133 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:08:04 Download gff for BO04802.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 238..1364 7..1132 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:21:34 Download gff for BO04802.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 271..1386 17..1134 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:39:20 Download gff for BO04802.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 238..1364 7..1132 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:16:04 Download gff for BO04802.complete
Subject Subject Range Query Range Percent Splice Strand
bsk-RB 271..1386 17..1134 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:16:04 Download gff for BO04802.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10249095..10249210 17..132 100   Minus
2L 10248785..10248914 133..262 100 <- Minus
2L 10248525..10248722 263..460 100 <- Minus
2L 10248197..10248461 461..725 100 <- Minus
2L 10247852..10248135 726..1009 100 <- Minus
2L 10247649..10247773 1010..1134 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:21:34 Download gff for BO04802.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10249095..10249210 17..132 100   Minus
arm_2L 10248785..10248914 133..262 100 <- Minus
arm_2L 10248525..10248722 263..460 100 <- Minus
arm_2L 10248197..10248461 461..725 100 <- Minus
arm_2L 10247852..10248135 726..1009 100 <- Minus
arm_2L 10247649..10247773 1010..1134 98 <- Minus

BO04802.pep Sequence

Translation from 16 to 1150

> BO04802.pep
MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNV
AIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQ
DVYLVMELMDANLCQVIQMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDL
KPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGY
TENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRL
QPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKM
LVIDPEQRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQ
WKELIYEEVMDYEAHNTNNRTRASFLDH

BO04802.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
bsk-PE 372 CG5680-PE 1..372 1..372 1979 100 Plus
bsk-PF 372 CG5680-PF 1..372 1..372 1979 100 Plus
bsk-PB 372 CG5680-PB 1..372 1..372 1979 100 Plus
p38a-PC 366 CG5475-PC 10..353 9..363 808 48.5 Plus
p38a-PB 366 CG5475-PB 10..353 9..363 808 48.5 Plus