Clone BO04817 Report

Search the DGRC for BO04817

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:48
Well:17
Vector:pDNR-Dual
Associated Gene/TranscriptCG5823-RA
Protein status:BO04817.pep: validated full length
Sequenced Size:883

Clone Sequence Records

BO04817.3prime Sequence

881 bp (773 high quality bases) assembled on 2005-12-02

> BO04817.3prime
ATGGTCTAGAAAGCTTGCTTCCTGATTCAGGTTCTTGATCACGTAATTAA
CAATGAGGGCAAAAATTGCAAAGCAGATAATGATCACCAGGTTTGAATAG
ACGGACTGCCAGTTTAGATAGGAGTTCCGTGCACTATTCTGGACCGCCGC
TCCTCCGCCGCTGGCCAAATCCGCCTGACCCGCCGCCCCGCCATCGATTG
CGTCCGCTGCATTCAGTGGATTGGCCAAGCCGCCCACCGCCAGATTGCCA
TCCGCAGATGCCAGGCTCGCTCCGTTGGCCAGTCCGTTGGAACGCTTTAC
TCCATTGGCAGCGGGTCCGTCCACAGCAGCTGCCGCCTGTGTTCCTCGCA
GCCGCTGCTTGATCTCTTCGACTATCTCCGGAAACAGCTCACAGAAGTTG
GTGTTGCGCAGGTTAAATGCTAGTGATTTTTGAGCAAACATTTGCTTGTC
ATAGTTCGATGATTCGATGGATCCGAGTGTGGGTGTGCTCTCCAGCATGA
AGCTCAGCAGTCCAGTGAGAATGGTGCCTACGCACCAAGTCGGGTTCCAA
GTGTCCGGATGAAAATCTGATATACTCAAACACAGTCTGGTGTTGGTCTT
GAAGCGACCGTTCGGCGTCAGCATGTAGATGGATGGCGGCTTGAATGGGA
ACTCGCGCGGAAAGAGCAGGGTGCCGTGGTAGTAGCCGCCGTAGTAGGGC
GAGTCCTCCGGCCCCTTGACGCAGTAGTGCCACTCGAGGATGTTGTTGGG
CAGCGGCTCGGCGGTTATGTACGGCAGGGGATCCCGCTTGAGGCGCATAT
AGTCCTGCTTCATGCGCGACACAGCAGTGGGTTGCTTCCGGCCGCCGGAC
GTCGACGACGAGGACATGTCGACTGATAACT

BO04817.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5823-PA 852 CG5823-RA 1..849 867..19 4245 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 01:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG5823-RB 1789 CG5823-RB 542..1391 868..19 4250 100 Minus
CG5823-RA 1850 CG5823-RA 603..1452 868..19 4250 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 01:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17532723..17533200 19..496 2390 100 Plus
3R 32079331 3R 17533623..17533924 567..868 1510 100 Plus
3R 32079331 3R 17533260..17533334 496..570 375 100 Plus
Blast to na_te.dros performed on 2015-02-12 01:11:53 has no hits.

BO04817.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:10:36 Download gff for BO04817.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5823-PA 1..852 18..867 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:27:14 Download gff for BO04817.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5823-PA 1..852 18..867 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 11:39:15 Download gff for BO04817.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 597..1452 19..875 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 05:08:44 Download gff for BO04817.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 597..1452 19..875 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 05:08:44 Download gff for BO04817.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 17533623..17533927 567..875 98   Plus
3R 17533260..17533330 496..566 100 <- Plus
3R 17532723..17533199 19..495 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 11:39:15 Download gff for BO04817.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13359345..13359649 567..875 98   Plus
arm_3R 13358982..13359052 496..566 100 <- Plus
arm_3R 13358445..13358921 19..495 100 <- Plus

BO04817.5prime Sequence

813 bp (812 high quality bases) assembled on 2005-11-29

> BO04817.5prime
GAAGTTATCAGTCGACATGTCCTCGTCGTCGACGTCCGGCGGCCGGAAGC
AACCCACTGCTGTGTCGCGCATGAAGCAGGACTATATGCGCCTCAAGCGG
GATCCCCTGCCGTACATAACCGCCGAGCCGCTGCCCAACAACATCCTCGA
GTGGCACTACTGCGTCAAGGGGCCGGAGGACTCGCCCTACTACGGCGGCT
ACTACCACGGCACCCTGCTCTTTCCGCGCGAGTTCCCATTCAAGCCGCCA
TCCATCTACATGCTGACGCCGAACGGTCGCTTCAAGACCAACACCAGACT
GTGTTTGAGTATATCAGATTTTCATCCGGACACTTGGAACCCGACTTGGT
GCGTAGGCACCATTCTCACTGGACTGCTGAGCTTCATGCTGGAGAGCACA
CCCACACTCGGATCCATCGAATCATCGAACTATGACAAGCAAATGTTTGC
TCAAAAATCACTAGCATTTAACCTGCGCAACACCAACTTCTGTGAGCTGT
TTCCGGAGATAGTCGAAGAGATCAAGCAGCGGCTGCGAGGAACACAGGCG
GCAGCTGCTGTGGACGGACCCGCTGCCAATGGAGTAAAGCGTTCCAACGG
ACTGGCCAACGGAGCGAGCCTGGCATCTGCGGATGGCAATCTGGCGGTGG
GCGGCTTGGCCAATCCACTGAATGCAGCGGACGCAATCGATGGCGGGGCG
GCGGGTCAGGCGGATTTGGCCAGCGGCGGAGGAGCGGCGGTCCAGAATAG
TGCACGGAACTCCTATCTAAACTGGCAGTCCGTCTATTCAAACCTGGTGA
TCATTATCTGCTT

BO04817.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 12:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5823-PA 852 CG5823-RA 1..797 17..813 3985 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 15:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG5823-RB 1789 CG5823-RB 542..1339 16..813 3990 100 Plus
CG5823-RA 1850 CG5823-RA 603..1400 16..813 3990 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 15:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17532775..17533200 813..388 2130 100 Minus
3R 32079331 3R 17533623..17533924 317..16 1510 100 Minus
3R 32079331 3R 17533260..17533334 388..314 375 100 Minus
Blast to na_te.dros performed on 2015-02-11 15:40:41 has no hits.

BO04817.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 02:10:37 Download gff for BO04817.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5823-PA 1..797 17..813 100   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 00:27:15 Download gff for BO04817.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5823-PA 1..797 17..813 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 19:34:37 Download gff for BO04817.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 597..1400 9..813 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:31:26 Download gff for BO04817.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 597..1400 9..813 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:31:26 Download gff for BO04817.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 17533623..17533927 9..317 98   Minus
3R 17533260..17533330 318..388 100 <- Minus
3R 17532775..17533199 389..813 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 19:34:37 Download gff for BO04817.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13359345..13359649 9..317 98   Minus
arm_3R 13358982..13359052 318..388 100 <- Minus
arm_3R 13358497..13358921 389..813 100 <- Minus

BO04817.complete Sequence

883 bp (883 high quality bases) assembled on 2005-09-08

GenBank Submission: FJ629873

> BO04817.complete
GAAGTTATCAGTCGACATGTCCTCGTCGTCGACGTCCGGCGGCCGGAAGC
AACCCACTGCTGTGTCGCGCATGAAGCAGGACTATATGCGCCTCAAGCGG
GATCCCCTGCCGTACATAACCGCCGAGCCGCTGCCCAACAACATCCTCGA
GTGGCACTACTGCGTCAAGGGGCCGGAGGACTCGCCCTACTACGGCGGCT
ACTACCACGGCACCCTGCTCTTTCCGCGCGAGTTCCCATTCAAGCCGCCA
TCCATCTACATGCTGACGCCGAACGGTCGCTTCAAGACCAACACCAGACT
GTGTTTGAGTATATCAGATTTTCATCCGGACACTTGGAACCCGACTTGGT
GCGTAGGCACCATTCTCACTGGACTGCTGAGCTTCATGCTGGAGAGCACA
CCCACACTCGGATCCATCGAATCATCGAACTATGACAAGCAAATGTTTGC
TCAAAAATCACTAGCATTTAACCTGCGCAACACCAACTTCTGTGAGCTGT
TTCCGGAGATAGTCGAAGAGATCAAGCAGCGGCTGCGAGGAACACAGGCG
GCAGCTGCTGTGGACGGACCCGCTGCCAATGGAGTAAAGCGTTCCAACGG
ACTGGCCAACGGAGCGAGCCTGGCATCTGCGGATGGCAATCTGGCGGTGG
GCGGCTTGGCCAATCCACTGAATGCAGCGGACGCAATCGATGGCGGGGCG
GCGGGTCAGGCGGATTTGGCCAGCGGCGGAGGAGCGGCGGTCCAGAATAG
TGCACGGAACTCCTATCTAAACTGGCAGTCCGTCTATTCAAACCTGGTGA
TCATTATCTGCTTTGCAATTTTTGCCCTCATTGTTAATTACGTGATCAAG
AACCTGAATCAGGAAGCAAGCTTTCTAGACCAT

BO04817.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG5823-RB 852 CG5823-PB 1..849 17..865 4245 100 Plus
CG5823-RA 852 CG5823-PA 1..849 17..865 4245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5823-RB 1789 CG5823-RB 542..1391 16..865 4250 100 Plus
CG5823-RA 1850 CG5823-RA 603..1452 16..865 4250 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17532723..17533200 865..388 2390 100 Minus
3R 32079331 3R 17533623..17533924 317..16 1510 100 Minus
3R 32079331 3R 17533260..17533334 388..314 375 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:43:45 has no hits.

BO04817.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:39:10 Download gff for BO04817.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 1..852 17..866 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:07:54 Download gff for BO04817.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 585..1440 9..865 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:23:19 Download gff for BO04817.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 604..1452 17..867 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:39:11 Download gff for BO04817.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 585..1440 9..865 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:54:36 Download gff for BO04817.complete
Subject Subject Range Query Range Percent Splice Strand
CG5823-RA 604..1452 17..867 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:54:36 Download gff for BO04817.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17533623..17533923 17..317 100   Minus
3R 17533260..17533330 318..388 100 <- Minus
3R 17532721..17533199 389..867 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:23:19 Download gff for BO04817.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13359345..13359645 17..317 100   Minus
arm_3R 13358982..13359052 318..388 100 <- Minus
arm_3R 13358443..13358921 389..867 99 <- Minus

BO04817.pep Sequence

Translation from 16 to 883

> BO04817.pep
MSSSSTSGGRKQPTAVSRMKQDYMRLKRDPLPYITAEPLPNNILEWHYCV
KGPEDSPYYGGYYHGTLLFPREFPFKPPSIYMLTPNGRFKTNTRLCLSIS
DFHPDTWNPTWCVGTILTGLLSFMLESTPTLGSIESSNYDKQMFAQKSLA
FNLRNTNFCELFPEIVEEIKQRLRGTQAAAAVDGPAANGVKRSNGLANGA
SLASADGNLAVGGLANPLNAADAIDGGAAGQADLASGGGAAVQNSARNSY
LNWQSVYSNLVIIICFAIFALIVNYVIKNLNQEASFLDH

BO04817.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG5823-PB 283 CG5823-PB 1..283 1..283 1490 100 Plus
CG5823-PA 283 CG5823-PA 1..283 1..283 1490 100 Plus
eff-PC 147 CG7425-PC 2..115 15..129 178 31.1 Plus
eff-PB 147 CG7425-PB 2..115 15..129 178 31.1 Plus
eff-PA 147 CG7425-PA 2..115 15..129 178 31.1 Plus